SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010319 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010319
Domain Number 1 Region: 8-169
Classification Level Classification E-value
Superfamily EF-hand 6.68e-48
Family Calmodulin-like 0.000000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010319   Gene: ENSBTAG00000007844   Transcript: ENSBTAT00000010319
Sequence length 172
Comment pep:known chromosome:UMD3.1:X:35382935:35386969:-1 gene:ENSBTAG00000007844 transcript:ENSBTAT00000010319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFKKANMASTTQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL
GFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK
ISFKNLKRVAKELGENLSDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY
Download sequence
Identical sequences C7BDV8 Q2TBN3
ENSBTAP00000010319 9913.ENSBTAP00000010319 ENSBTAP00000010319 NP_001033604.1.59421 NP_001033604.1.76553 NP_001157066.1.54773 NP_001157066.1.66739 XP_005888849.1.15283 XP_006055597.1.26621 XP_019811812.1.53367 XP_020759264.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]