SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010668 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000010668
Domain Number - Region: 54-131
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0108
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010668   Gene: ENSBTAG00000008110   Transcript: ENSBTAT00000010668
Sequence length 156
Comment pep:known chromosome:UMD3.1:19:20372730:20379655:-1 gene:ENSBTAG00000008110 transcript:ENSBTAT00000010668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHLSLADPVREPLFSGEAGRQTAMAKDILAEAGLHFDELNKLRVLDPEVSQQTIELKEE
CKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQAL
IAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
Download sequence
Identical sequences Q58CS6
9913.ENSBTAP00000010668 ENSBTAP00000010668 ENSBTAP00000010668 NP_001013621.1.59421 NP_001013621.1.76553 XP_005220127.1.76553 XP_005220128.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]