SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010670 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010670
Domain Number 1 Region: 174-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000233
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 212-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000084
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010670   Gene: ENSBTAG00000008113   Transcript: ENSBTAT00000010670
Sequence length 326
Comment pep:known chromosome:UMD3.1:11:79487139:79494238:1 gene:ENSBTAG00000008113 transcript:ENSBTAT00000010670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP
AMHLPRSSFSKVPGAVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSGPAALKTKPRFDF
ANLALAATQEDPSKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKF
CGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKG
FCQSRTLAVHKTLHSQVKELKPPRSNAKQSLRVNRTLGHAAPSSGGNRSPRRLWRAARGA
PGTFLHPKRVPRVPGARGTSQPRPGP
Download sequence
Identical sequences A0A140T875
ENSBTAP00000010670 ENSBTAP00000010670 9913.ENSBTAP00000010670 XP_010838821.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]