SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010676 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010676
Domain Number 1 Region: 141-322
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-60
Family Brix domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010676   Gene: ENSBTAG00000008118   Transcript: ENSBTAT00000010676
Sequence length 349
Comment pep:known chromosome:UMD3.1:3:59792647:59809111:-1 gene:ENSBTAG00000008118 transcript:ENSBTAT00000010676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAGDKSGGSGKKGLKRKAATEESQEAAVGEDGTTESGVQPPKTAAFPPGFSISEIKNK
QRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDKAPPKPVPKTIDNQRVYDETIVDPND
EEVAYDEATDEFASYFNRQTSPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLAL
KKIIPQCISRDFTDLIVINEDRKIPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPT
EHIPEIILNNFTTRLGHSIGRMFASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFKSE
KKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL
Download sequence
Identical sequences A4FUG9 L8J180
ENSBTAP00000010676 9913.ENSBTAP00000010676 NP_001076886.1.59421 NP_001076886.1.76553 XP_005887477.1.15283 XP_010858604.1.44457 ENSBTAP00000010676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]