SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010747 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010747
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.14e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 341-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 191-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000133
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000010747
Domain Number - Region: 388-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0151
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010747   Gene: ENSBTAG00000008175   Transcript: ENSBTAT00000010747
Sequence length 423
Comment pep:known chromosome:UMD3.1:25:27875669:27895361:1 gene:ENSBTAG00000008175 transcript:ENSBTAT00000010747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQESLTFQDVAVDFTREEWDQLYPAQKNLYRDVMLENYRNLVALGHQLYKPEVITQLEQ
EEQWMMGRVSPPDTHPDGENRPEIKKSNHNMSDENQTHDMIMERLTGDSFWYSILGGLWE
FDYQLEFNQENQQRYLGQVSFTHKKITQERGLECSRFGENYNLNSNLLMQQRIPSMKIPL
NSDTQGNSIKRNSDLIYYQGNYVRENPYEYNECGKIFNQHLLLTSHIHTEGKHSECRKAF
SQNSSLTQPQMVLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEKPFICNECGKAFRQHS
SFTQHLRIHTGEKPYKCNQCGKAFSRITSLTEHHRLHTGEKPYECSFCGKAFSQRTHLNQ
HERTHTGEKPYKCNECEKAFSQSAHLNQHRKIHTREKLCEYNKCEKTLSHSPSLTPQHIT
QNF
Download sequence
Identical sequences A8SM77
ENSBTAP00000010747 9913.ENSBTAP00000010747 ENSBTAP00000010747 NP_001103914.1.59421 NP_001103914.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]