SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010787 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010787
Domain Number 1 Region: 404-518
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.75e-18
Family Mannose 6-phosphate receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000115
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000010787
Domain Number - Region: 208-256
Classification Level Classification E-value
Superfamily EF-hand 0.000212
Family Polcalcin 0.064
Further Details:      
 
Domain Number - Region: 30-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000262
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010787   Gene: ENSBTAG00000008202   Transcript: ENSBTAT00000010787
Sequence length 533
Comment pep:known chromosome:UMD3.1:7:17034684:17048121:1 gene:ENSBTAG00000008202 transcript:ENSBTAT00000010787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLPMCWAVEVRRPRGVSLTNHHFYDESKPFTCLDGSASIPFDQVNDDYCDCKDG
SDEPGTAACPNGSFHCTNTGYKALYISSRWVNDGVCDCCDGTDEYNSGIVCENTCKEKGR
KERETLQQMAEVTREGFRLKKILIEDWKKAREEKQKKLIELQAGKKSLEDQVEVLRTLKE
EAEKPEEAAKDQHRRLWEEQQAISKEQRERELAASAFQELDDDMDGAVSVAELQTHPELD
TDGDGALSEGEAQTLLGGDAQMDAAFFYDRVWAAIRDKYRSEVLPTEYPPSPPAPDVMEP
KEEQPPMPSPPTEEEDEDEEDEETEEDEDEEDEDSQGEQPKDAPPPAPAPQTASPTEEDR
MPPYDEQTQAFINAAQEARNKFEEAERSLKDMEESIRNLEQEISFDFGPNGEFAYLYSQC
YELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGP
NRSTTVRLLCGKETVVTSTTEPSRCEYLMELMTPAACPEPPPEYPVEGDHDEL
Download sequence
Identical sequences L8IXR9 Q28034
ENSBTAP00000010787 NP_788835.1.59421 NP_788835.1.76553 XP_005208774.1.76553 9913.ENSBTAP00000010787 ENSBTAP00000010787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]