SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010820 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010820
Domain Number 1 Region: 4-218
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.16e-52
Family LplA-like 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010820   Gene: ENSBTAG00000008227   Transcript: ENSBTAT00000010820
Sequence length 226
Comment pep:known chromosome:UMD3.1:15:54616841:54618047:-1 gene:ENSBTAG00000008227 transcript:ENSBTAT00000010820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLQPAVRLVWLSQVPYAELLALQQRWLLRLQAEPGPEAGALLLCEPAGPVYTTGLRGGL
TSEDTARLRALGAEVLPLGRGGLATFHGPGQLLCHPVLDLRPLGLRLRAHVAALEACAVR
LCELLGLPGARARPPPYTGVWLGERKICAIGVRCGRHVTSHGLALNCSTDLTWFEHIVPC
GLVGTGVTSLSEELQRHVTVDEVIPRFLEAFKETYKCTLTSEDSPS
Download sequence
Identical sequences E1BI46
ENSBTAP00000010820 ENSBTAP00000010820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]