SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010907 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010907
Domain Number 1 Region: 9-61,111-171
Classification Level Classification E-value
Superfamily POZ domain 6.28e-21
Family BTB/POZ domain 0.0052
Further Details:      
 
Domain Number 2 Region: 326-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000128
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 227-251,299-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000278
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010907   Gene: ENSBTAG00000008289   Transcript: ENSBTAT00000010907
Sequence length 1010
Comment pep:known chromosome:UMD3.1:19:27769639:27773345:-1 gene:ENSBTAG00000008289 transcript:ENSBTAT00000010907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMPPPAEVTDPSHAPAALRQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREAL
LASAPLPLPPITGGSAPNPTTTTAASSSSSSSSSSSSSSSSSSSSSPSPASPSASSPPRV
LELPGVPAAAFSDVLNFIYSARLALPGGGGDGAAVAEIGALGRRLGISRLQGLGEGGDAW
VPPAPVPMATSQPEEDSFGPGPRPAGEWEGDRAEAQGPDSQPALSRRPLPCPRCGKSFIH
PKRLQTHEAQCRREASARGSAGLGARGSVPSGPAGVDASALPPAVGFRGGPEHVVKVVGG
HVLYVCAACERSYVTLSSLKRHSNVHSWRRKYPCRYCEKVFALAEYRTKHEVWHTGERRY
QCIFCWETFVTYYNLKTHQRAFHGISPSLLASEKTPNGGYKPKLNTLKLYRLLPMRAAKR
PYKTYSQGAPEAPLSPSLNTAAPVAMPASSPPGPAPAPEPGPPPSVITFAHPAPSVIVHG
GSSSGGAGSGPASTGGAQAASVITYTAPPRPPKKREYPPPPPEPAAAPTSPATAGSPATA
AGPATAMEEAKGRNPRATRTLTYTAKPAGGIGGGAGPPAGPGRGPSQLQAPPPLCQITVR
IGEEAIVKRRISETDLRPGELSGEEMEESEEEEEDEEEEEEEEEEGQGESKAGGEDQLWR
PYYSYKPKRKAGAVAPASSGGSGMPRSRRPPRWRQKLERRSWEETPAADGPTGRARGERR
HRCEDCAQTFASLRKLRKHQESHSGGPHSSRSGRKPSTRLTCPHCAKVCKTAAALSRHGQ
RHAAERPGGTPTPVIAYSKGSTGARAGEIKEEAPQEMQVSSSSGEAGGGGGSAPAEEASE
PASLQDPVISGGEEPSVGAGGATYAYPPVQEFPLALIGSGRESGSGRGKGGSEGPGGAGG
GDRMEAMGAAKVTFYPEPYPLVYGPQLLAAYPYNFSNLAALPVALNMVLPDEKGGGALPF
LPGVFGYAVNPQAAAPTPPTPPPPTLPPPVAPKGEGERAGVERTQKGDVG
Download sequence
Identical sequences F1MFQ4
ENSBTAP00000010907 ENSBTAP00000010907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]