SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011050 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011050
Domain Number 1 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-24
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 527-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.00078
Further Details:      
 
Domain Number 9 Region: 167-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000011050
Domain Number - Region: 99-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0032
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011050   Gene: ENSBTAG00000008397   Transcript: ENSBTAT00000011050
Sequence length 624
Comment pep:known chromosome:UMD3.1:7:22088469:22099654:-1 gene:ENSBTAG00000008397 transcript:ENSBTAT00000011050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVVFEDVAVNFTLEEWALLDSSQKELYRDVMLETFRNLASVDGETQYKANGSVSQQDI
YRNKISKEHKISKFTGNDSWPFVLGKVWEELSIEDQYTYQSRHPRNHVVERLQESNDQYG
EGFSQIPNLNLYQKTLTGVKQYEYSPYKKAFMHRSLKNHSTACTGHKPYQCQECGQAYSS
HSHLRTHVRIHNGERPFVCKLCGKTFPRTSSLNRHIRIHTAEKTYECQQCGKAFIDFSSL
TSHVRTHTGEKPYQCKECEKAFSYSSTFRRHMITHTGEKPYKCMECGEAFSYSSTFRRHM
ISHTGETPHKCKECGEAFSYSSAFRRHMITHTGEKPYECKQCGKTFIYLQSFRRHERIHT
GEKPYECKQCGKTFIYPQSFRRHERTHGGEKPYECDQCGKAFSHPSSFRGHMRVHTGEKP
YKCSQCGKTFNWPISLRKHLRTHTKEKPFECKQCGKAFNLSACFREHVRMHPGDKSYECK
LCGKAFYCHLSLQKHMRRHTAEKLYECEQCQKAFSWPELLQQHVRTHTAEKPYKCKECGK
VFKWPSSLPIHMRMHTGEKPYECKQCGKAFSCSSSLRRHARIHTVEKHYICNGENPANEL
MHSASENSHEERNLIKVANLVLPL
Download sequence
Identical sequences F1N143
ENSBTAP00000011050 9913.ENSBTAP00000011050 ENSBTAP00000011050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]