SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011100 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011100
Domain Number 1 Region: 342-517
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.83e-50
Family Cell cycle control phosphatase, catalytic domain 0.0000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011100   Gene: ENSBTAG00000008436   Transcript: ENSBTAT00000011100
Sequence length 533
Comment pep:known chromosome:UMD3.1:13:51853965:51863562:-1 gene:ENSBTAG00000008436 transcript:ENSBTAT00000011100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPQPESVAGSALSPAGMRGGAQRPGHLPGLGLGAHGLLGSPERAAASSPVTTLTQTMH
HLAGLGSETPKSQVGSLLTCLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPNMAEQT
FEQAIQAASRVIQNEQFAIRRFQSLPDGFVFKMPGKLKHPSHSRALGEWASRREAFAQRP
SSAPDLMCLTPERKMEVEELIPLARCQFSVTPSTGAVEEDDGFVDILETDLKENDVVPPG
MESLISAPLVKTSEKEEEQDLIMYSKCQRLFRSPSMPCGVIRPILKRLERPQDRDLPVQN
KRKRSVTPPEEELQEAEEPKARILRSKSLCHDEIENILDSDHRELIGDYSKAFLLQTVDG
KHQDLKYISPETVVALLTGKFSHIVEKFVIVDCRYPYEYEGGHIKTAVNLPLERDAETFL
LQSPITPCSLDKRIILIFHCEFSSERGPRMCRFIRERDRASNDYPSLYYPEMYILKGGYK
DFFPQHPTFCEPQDYRPMNHEDFKDEMKTFRLKTRSWAGERSRRELCSRLQDQ
Download sequence
Identical sequences E1BL76
ENSBTAP00000011100 NP_001178344.1.59421 NP_001178344.1.76553 ENSBTAP00000011100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]