SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011264 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011264
Domain Number 1 Region: 1124-1176
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-18
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 993-1043
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000139
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 442-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000013
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 697-748
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000566
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 734-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000616
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011264   Gene: ENSBTAG00000008544   Transcript: ENSBTAT00000011264
Sequence length 1316
Comment pep:known chromosome:UMD3.1:18:19640447:19654562:-1 gene:ENSBTAG00000008544 transcript:ENSBTAT00000011264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQAKPQHFQSDPEVASLPRRDGDTEKGQPNRTTKSKDAHVCGRCCAEFFELSDLLL
HKKNCTKNQLVLIVNESPASPPETFSSPSPPPDHPQEQMNDTANKTEQGECSDLAEAQAP
DREESMEVEAPAAPKGASGPPSSAGDSSVPPSCSSSSSGAGTSAITTSLPQLGDLTTLGN
FSVINSNVIIENLQSTKVAVAQFSQEARCNGASGGKLAVPALMEQLLALQQQQIHQLQLI
EQIRHQILLLASQNADLPTSSSPSPGTLRTSANPLSTLSSHLSQQLAAAAGLAQSLASQS
ASISGVKQLPPIQLPQSSSGNTIAPPHSGSSPNVHILAAAVPTPSSEKVASSAGTSHTSN
PAASASSSPAFAISSLLSPASNPLLPQPAPANSVFPSPLPNIGTTAEDLNPLSALAQQRK
SKPPNVTAFEAKSASDEAFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFS
TKGNLKVHFQRHKEKYPHIQMNPYPVPEHLDNIPTSTGIPYGMSIPPEKPVTSWLDTKPV
LPTLTTSVGLPLPPTLPNLTPFIKTEEPAPIPISHSAASPPGSVSSDSGAPEPAARNPGG
LPEEAEGPTAPPPGGKSEESGVVPSSASAPNACVLSSLASDGGPGSASTFTNPLLPLMSE
QFKAKFPFGGLLDSAQASETSKLQQLVENIDKKATDPNECIICHRVLSCQSALKMHYRTH
TGERPFKCKICGRAFTTKGNLKTHYSVHRAMPPLRVQHSCPICQKKFTNAVVLQQHIRMH
MGGQIPNTPVPDSYPESMESDTGSFDEKNFDDLDTFSDENMEDCPEGSIPDTPKSADASQ
DSLSSSPLPLEMSSIAALENQMKMINAGLAEQLQASLKSVENGSVEGDVLTNDSSSVGGD
MESQSAGSPAISESTSSMQALSPSNSTQEFHKSPSAEEKLQRAGASEFANGLSPAPVNGG
ALDLTSSHTEKIIKEDSLGILFPFRDRGKFKNTACDICGKTFACQSALDIHYRSHTKERP
FICTVCNRGFSTKGNLKQHMLTHQMRDLPSQLFEPSSSLGPNQNSAVIPANSLASLIKTE
VNGFVHVTPQDSKDTPTSHVPSGPLSSSATSPVLLPALPRRTPKQHYCNTCGKTFSSSSA
LQIHERTHTGEKPFACTICGRAFTTKGNLKVHMGTHMWNSTPARRGRRLSVDGPMTFLGG
NPVKFPEMFQKDLAARSGSGDPSSFWNQYAAALSNGLAMKANEISVIQNGGIPPIPGSLG
SGSSSPISGLTGNLEKLQNSEPSAPLAGLEKMASSENGTNFRFTRFVEDSKEIVTS
Download sequence
Identical sequences E1BIR3
NP_001192719.1.59421 NP_001192719.1.76553 XP_005218629.1.76553 ENSBTAP00000011264 9913.ENSBTAP00000011264 ENSBTAP00000011264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]