SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011532 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011532
Domain Number 1 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 220-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 468-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.38e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011532   Gene: ENSBTAG00000034005   Transcript: ENSBTAT00000011532
Sequence length 529
Comment pep:known chromosome:UMD3.1:22:16494276:16502686:1 gene:ENSBTAG00000034005 transcript:ENSBTAT00000011532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTELREAVALAHWGPVTVKKEEEEEEGFVGQASSQQVHSENIKVWAPGEAPQTCLPVSE
QEEKGQNMFWDMAVVLKPTQEAPAASTPGSSSLPGTLAKSELLDTHGNMACLGAETKNRQ
LLVPKIEICDETEKSFIVSGRIQKVDPQGPKLGEACENRNMLKRQRIKREQKDFGQVTVK
DCHLPENLKEEEDQKCPKAEERYTLSSGSVKNQKSQPGQKPFTCGVCGKGFSQSANLVVH
QRIHTGEKPFECHQCGKAFIQSANLVVHQRIHTGQKPYVCSKCGKAFTQSSNLTVHQKIH
SLEKTFKCNECEKAFSYSSQLGRHQKVHITEKCYECNECGKTFTRSSNLIVHQRIHTGEK
PFACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDC
SECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYTCNECG
KSFRQRSSLTVHQRTHTGEKPYECAKCGAAFISNSHLMRHHRTHLVEST
Download sequence
Identical sequences E1BDQ3
ENSBTAP00000011532 XP_015314955.1.76553 ENSBTAP00000011532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]