SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011678 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011678
Domain Number 1 Region: 14-360
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.88e-139
Family Calpain large subunit, catalytic domain (domain II) 0.000000000017
Further Details:      
 
Domain Number 2 Region: 366-528
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 5.76e-57
Family Calpain large subunit, middle domain (domain III) 0.0000000721
Further Details:      
 
Domain Number 3 Region: 532-714
Classification Level Classification E-value
Superfamily EF-hand 1.34e-46
Family Penta-EF-hand proteins 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011678   Gene: ENSBTAG00000010230   Transcript: ENSBTAT00000011678
Sequence length 716
Comment pep:known chromosome:UMD3.1:29:44064429:44089990:1 gene:ENSBTAG00000010230 transcript:ENSBTAT00000011678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEFITPVYCTGVSAQVQKQRAKELGLGRHENAIKYLGQDYEQLRVHCLQRGALFRDEA
FPPVPQSLGFKELGPNSSKTYGIKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQDGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYNIILK
ALERGSLLGCSIDISSILDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYMREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
QRFRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPDPDDYGGRESGCS
FLLALMQKHRRRERRFGRDMETIGFAVYEVPPELMGQPAVHLKRDFFLSNASRARSEQFI
NLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTQELDDQVQANLPDEQVL
SEEEIDENFKSLFRQLAGEDMEISVKELRTILNRIISKHKDLRTTGFSLESCRSMVNLMD
RDGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIEFAGFKLNKKLYEL
IITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Download sequence
Identical sequences Q27970
ENSBTAP00000011678 ENSBTAP00000011678 NP_776684.1.59421 NP_776684.1.76553 XP_019810615.1.53367 XP_019810616.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]