SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011774 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011774
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-40
Family SCAN domain 0.0000347
Further Details:      
 
Domain Number 2 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 455-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 549-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 249-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000041
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 332-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000184
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 415-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000253
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011774   Gene: ENSBTAG00000008943   Transcript: ENSBTAT00000011774
Sequence length 613
Comment pep:known chromosome:UMD3.1:23:30079857:30091413:1 gene:ENSBTAG00000008943 transcript:ENSBTAT00000011774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYTWSIQAMKDREELLEVKIEEEELEEEHKYATTQDQNLQKNTTHSREVFRRYFRQFCY
QETSGPREALSRLRELCHQWLKPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPESG
EEVVTVLEDLERELDEPGYQVSVRSEEQELQEIVPLRTEQEPRICLQSVQAQPKCESAEL
EAQQKQDIETGNEYRNLKQEVSPEMKPYGNIASKFENEMSQPARYEKTYEPEEKTGESSE
YSREDKEPTCDENGVSLTENLDLSEHQRICPGEKPYVCDVCGRAFSQHSRFVEHQRIHTG
DRPYKCKECGKTFRGRTVLIRHKIIHTGEKLYKCNECGKAFAQWSALNQHQRLHTGEKHY
HCNECGKAFSQKAGLFHHLKIHTRDKPYHCTQCNKSFSRRSILTQHQGVHTGAKPYECSE
CGKAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLTQHQRIHNGEKPYKCDVCGKAF
IQRTSLIEHQRIHTGERPYQCDKCGKAFTQRSVLKEHQKVHTGERPYKCNECGNAFRGIT
SLIQHQRIHTGEKPYQCDECGKAFRQRSDLSKHQRIHNRGDPYTCKVRGESFTQNSALIQ
HQTTHKAEKSGSV
Download sequence
Identical sequences Q08E61
ENSBTAP00000011774 9913.ENSBTAP00000011774 ENSBTAP00000011774 NP_001070606.1.59421 NP_001070606.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]