SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011834 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011834
Domain Number 1 Region: 66-305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.33e-59
Family G proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 286-366
Classification Level Classification E-value
Superfamily TGS-like 5.23e-19
Family G domain-linked domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011834   Gene: ENSBTAG00000008990   Transcript: ENSBTAT00000011834
Sequence length 367
Comment pep:known chromosome:UMD3.1:17:72273494:72288386:1 gene:ENSBTAG00000008990 transcript:ENSBTAT00000011834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVA
KTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPG
IIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIG
FKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVY
IPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKG
QLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDED
VIQIVKK
Download sequence
Identical sequences A0A0P6IYF3 A0A1U7TW79 A0A286X768 A0A2K5MTD2 A0A2K5R4V1 A0A2K5WN51 A0A2K5XBB0 A0A2K6EEV0 A0A2K6JYL2 A0A2K6R097 A9CB32 B0KWR4 B1MTR3 B3RF73 B7NZM4 F6TF39 G1LKH5 G3R6F5 H2QLI6 I3MMF8 J9P0A6 K9IJ10 L5L4X6 L8HT62 L9KZK1 M3VWF5 M3YN08 Q3MHP5 Q9Y295 S9X020 W5PKV5
Hs4758796___KOG1487 ENSCJAP00000020342 ENSMPUP00000012715 ENSCPOP00000009688 ENSOCUP00000016101 ENSCPOP00000009688 ENSSTOP00000012712 ENSOCUP00000016101 ENSPANP00000013176 ENSMMUP00000025115 ENSCAFP00000038978 ENSGGOP00000010905 ENSFCAP00000001229 ENSP00000329715 ENSOARP00000011078 GO.42014 NYSGXRC-T556 ENSAMEP00000007437 ENSPTRP00000024582 gi|4758796|ref|NP_004138.1| ENSCJAP00000020342 ENSBTAP00000011834 ENSMPUP00000012715 ENSCAFP00000035872 ENSPTRP00000024582 ENSBTAP00000011834 ENSSTOP00000012712 NP_001029863.1.59421 NP_001029863.1.76553 NP_001164823.1.1745 NP_001253866.1.72884 NP_004138.1.87134 NP_004138.1.92137 XP_002743739.1.60252 XP_002915595.1.58354 XP_003478344.1.53824 XP_003821528.1.60992 XP_003994869.1.62641 XP_004017543.1.66739 XP_004063391.1.27298 XP_004283740.1.21590 XP_004314389.1.83887 XP_004400067.1.74151 XP_004592061.1.84141 XP_004615632.1.94378 XP_004625255.1.9945 XP_004690986.1.23501 XP_004766439.1.14098 XP_004843543.1.39548 XP_005339923.1.77405 XP_005396368.1.28644 XP_005567605.1.63531 XP_005691711.1.57651 XP_005908571.1.15283 XP_005961246.1.78601 XP_006051078.1.26621 XP_006148016.1.99106 XP_006184834.1.101512 XP_006185946.1.101512 XP_006218095.1.17985 XP_006904998.1.64745 XP_007082633.1.5354 XP_007128772.1.24612 XP_007170715.1.59432 XP_008060678.1.4292 XP_008564650.1.73410 XP_008708812.1.72690 XP_010358982.1.97406 XP_010602130.1.5607 XP_010827100.1.44457 XP_010947408.1.22495 XP_010990555.1.51371 XP_011382576.1.92234 XP_011834410.1.47321 XP_011893294.1.92194 XP_011968186.1.54773 XP_012513435.1.63892 XP_012619425.1.48125 XP_014936960.1.86478 XP_015360421.1.40921 XP_015985033.1.101085 XP_016794492.1.37143 XP_017355026.1.71028 XP_017498278.1.32401 XP_017724480.1.44346 XP_019282286.1.44245 XP_019832882.1.53367 XP_020727292.1.74333 XP_021559205.1.83697 XP_515085.2.37143 XP_534738.2.84170 ENSTTRP00000009752 ENSTTRP00000009752 ENSGGOP00000010905 ENSP00000329715 ENSMMUP00000025115 10141.ENSCPOP00000009688 9544.ENSMMUP00000025115 9598.ENSPTRP00000024582 9600.ENSPPYP00000013090 9606.ENSP00000329715 9913.ENSBTAP00000011834 9986.ENSOCUP00000016101 ENSAMEP00000007427 ENSP00000329715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]