SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012076 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012076
Domain Number 1 Region: 219-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 44-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 359-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 274-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 163-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 9 Region: 568-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000153
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 321-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000253
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012076   Gene: ENSBTAG00000012522   Transcript: ENSBTAT00000012076
Sequence length 655
Comment pep:known chromosome:UMD3.1:18:52380158:52391523:1 gene:ENSBTAG00000012522 transcript:ENSBTAT00000012076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGSLQHTWTKASFSFCSSGFSGLCASPIEELYGALISSWDSRTMTDGMVTFRDVAIDFSQ
EEWEFLDPAQRDLYVDVMLENYSNLVSLDLESTYETKNTLSKKDIFEINFSQWKIKERSK
TIELEASIFKNNWKCKSRFKGLQGHQERLFSQVIISYEKMPTYKKHESLIAHQRTPNQEK
PYICKECGKAYRHGSKLVQHERIHMAKKHFECKECGKDFLSAYQLTVHQRFHTGEKPYEC
KECGKTFSWGSSLVKHERIHTGEKPYECKECGKAFSRGYHLTQHQKIHIGVKSYECKECG
KAFFWGSSLAKHEIIHTGEKPYKCKECGKAFSRGYQLTQHHKIHTGKKPYVCKICGRGFC
WGYQLTRHQIFHTGKKPYECKECGKTFNCGSSLVQHERIHTGEKPYECKECGKAFSRGYH
LTQHQKIHTGEKPFECKECGKAFSWGSSLVKHERVHSGEKSYECKECGKTFGSGYQLTRH
QIFHTGEKPYKCKACGKAFNCGSSLVQHERIHTGEKPYECKECGKTFSRGYHLTQHQKIH
TGEKPFKCKECGKAFSWGSSLVKHERVHTGEKYYECRDCGKVFNSDYQLSVHQRFHTGEK
PYQCKEFGKTFTCGVSHVQHERISNNDKPYKYKEYGEAFIWTAYSNGAVDAGETL
Download sequence
Identical sequences E1BLR3
ENSBTAP00000012076 ENSBTAP00000012076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]