SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012119 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012119
Domain Number 1 Region: 216-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 257-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000561
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 168-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000582
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012119   Gene: ENSBTAG00000009199   Transcript: ENSBTAT00000012119
Sequence length 524
Comment pep:known chromosome:UMD3.1:25:3492818:3497250:1 gene:ENSBTAG00000009199 transcript:ENSBTAT00000012119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLDEPLDLKLSITKLRAAREKRERTLSAARHRALHRELGLADDSPTPGSPGSPPSGFL
LNPKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPTAPAGPDLQPL
RYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPELPLPKQLVCRWAKCNQPFE
LLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTC
SKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC
HKRYTDPSSLRKHIKAHGHFVSHEQHELLQLRPPPKPPLPAPDGSPYVSGAQIIIPNPAA
LFGGPGLPGLPLPLAPGPLDLSALACGNGGGAGGAGGMGPGLPGPVLPLNLAKNPLLPSP
FGAGGLGLPVVSLLAGSAGGKAEGEKGRGAMPARALSSEGRKTPLERTEGSRSRPSPDGL
PLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN
Download sequence
Identical sequences E1BKE4
9913.ENSBTAP00000012119 ENSBTAP00000012119 NP_001192877.1.59421 NP_001192877.1.76553 XP_005224542.1.76553 XP_019843231.1.53367 ENSBTAP00000012119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]