SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012236 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012236
Domain Number 1 Region: 253-442
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.46e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 
Domain Number 2 Region: 419-526,638-719
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.46e-37
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012236   Gene: ENSBTAG00000009288   Transcript: ENSBTAT00000012236
Sequence length 737
Comment pep:known chromosome:UMD3.1:X:91741937:91755079:1 gene:ENSBTAG00000009288 transcript:ENSBTAT00000012236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPCAKRGVGRVAWRPLRLRQGTRWGRGRPHSGVRTRVATVSCHPEVGGSRMATASGSSDL
AGSGAPSPGGGAQAAAAEEEEREVVRVRVKKCESFLPLEFRSFAVDPQITSLDVLQHILI
RAFDLNGKKNFGISYLGRDRMGQEAYLSLLSDWDLSTAFATASKPYLHLRVDIRPTEDSP
LLEDWDIISPKDVIGSDVLLAEKRSSLTTAALPFTQSIISQVGRTLSKVQQVLSWSYGED
VKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLLNVYPDGLTG
RERMDYMKRKSREYEQLKSEWAQRASPEDLEFIRSTVLKDVLRTDRAHPYYAGPEDGPHL
RALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHAFVCFCGIMKRLAANFHPDGR
AMATKFAHLKLLLRHADPDFYQYLQEAGADDLFFCYRWLLLELKREFAFDDALRMLEVTW
SSLPPDPPEHEVELVGPPSLVVDMGFGSHRGRPMRQRHMLRPAGGGGGAFEDAVDHLTTS
SQGPGGGGRLLRQASLDDLQQLRDRTGPRRDSLIQLPYPAALIGSKSLSEPLLNSSDPLL
SPSSHPDSPSSSSPPSTQDASPAGDVAAGSPLMPEVGSPQDSGKSLPPPPPLGLPPPQEF
GRGNPFMLFLCLAILLEHRDHIMRNGLDYNELAMHFDRLVRKHHLGRVLRRAKALFADYL
QSEMWDSEEGAEATAPS
Download sequence
Identical sequences E1BHZ5
ENSBTAP00000012236 ENSBTAP00000012236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]