SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012578 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012578
Domain Number 1 Region: 49-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-20
Family HkH motif-containing C2H2 finger 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012578   Gene: ENSBTAG00000009562   Transcript: ENSBTAT00000012578
Sequence length 134
Comment pep:known chromosome:UMD3.1:2:127523710:127524790:-1 gene:ENSBTAG00000009562 transcript:ENSBTAT00000012578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQVATRPRPDPGAEPDPDLPGGGL
HRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYIPPQRLAVP
TEVSTEVPEMDTST
Download sequence
Identical sequences F1N7I8
ENSBTAP00000012578 NP_001179115.1.59421 NP_001179115.1.76553 XP_005895935.1.15283 XP_010828395.1.44457 XP_019836349.1.53367 ENSBTAP00000012578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]