SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012582 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012582
Domain Number 1 Region: 2-118,150-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-75
Family Calponin-homology domain, CH-domain 0.0000411
Further Details:      
 
Domain Number 2 Region: 6145-6300
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 5925-6051
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-17
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 4863-5004
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 6054-6163
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000064
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 6 Region: 6571-6717
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000372
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 7 Region: 5827-5959
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000374
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 8 Region: 5196-5330
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000038
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 9 Region: 5714-5867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000222
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 10 Region: 6472-6610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000342
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 11 Region: 5019-5120
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000667
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 12 Region: 3686-3833
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000091
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 13 Region: 3165-3270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000168
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 14 Region: 1456-1572
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000212
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 15 Region: 3263-3418
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000281
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 16 Region: 5610-5746
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000768
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 17 Region: 1880-2001
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000104
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 5514-5615
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000165
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 19 Region: 2706-2803
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000561
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 20 Region: 2068-2184
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000815
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number 21 Region: 2246-2328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000389
Family Spectrin repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012582   Gene: ENSBTAG00000025450   Transcript: ENSBTAT00000012582
Sequence length 6843
Comment pep:known chromosome:UMD3.1:10:76362023:76481666:1 gene:ENSBTAG00000025450 transcript:ENSBTAT00000012582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEQEDTQKKTFTCWINSQLAKHTPPSVVTDLFTDIKKGHVLLDLLEVLSGQQLPRDKGSN
TFQCRINIENALTFLQNQSIKLINIHVTDIIDGNPSIVLGLIWTIILHFHIEELARTLPG
NYSQPSLDSVSAVDSSPTSSPPAKKCSKVQERWRMSAKKALLQWAQEQCASYESVNVTDF
KSSWRNGMAFLAVIHALRPDLIDMKSVKHRSNRDNLKEAFRIAEQELKIPKMLEPEDVDV
VNPDEKSIMTYVAQFLQYSKKAPGSGDEAQGKVKDAMVWLALQEKKVHKMLTDSENETYC
KTYESLLSFLESFNKEKERFLDVLTIKRNVDDLNKDQLQLREAWDGLNYQINVWQTELNR
VLPSPLYQIETWLQEVEKLIDEDLSVSQDYSEAMALTQEKITLFQSLMDKFDCHLNTLLA
FENRDENHLPLVPPEKLEEMKRRINNISGKKVIPRLEFHYYECSVLGLLEEVKSKLLVWN
IKYGSKESVELLLEDWHKFIEEKEFLAQLETSFQKCEEIHNNLAGEYPNISKQYTMVKYH
FSMYRENILNVKSTLQKVLACWATYVENLRLLKACFEETKKEQMKEVPFETLSQWNLQHT
TLNEVGNFLFQVSNDEVGSSISKELKRLNKRWRKLITKAQPEVNLPLMKLQDEPFLDNSG
NIQLSKEENLAVGFSTYRSINAGEVHEKENEDFSGPLKVAKEVEKLIGQVETWEAETTSV
LDLLRQQDDVETSVEESLQHLIAKGSMYEELVSRIEDTLQMDVQHVSSQESLQHVLTAGL
QAKIQEAKEKVQISMIKLVAVLKNSTDVSQDLDVRLKVEETQKELESYITRAEQLLGQKE
SQRGLITKYKEALIISNTKSLAKYLKAVEELKNNVTDDVKLSLEEKSRDICAKWESLHHE
MSLYIQQLKIDIEKGKLSDSIAKLEKQINKEKKLIRRGRTKGLIKEHEACFSEEGSLYQL
DHHMDVLRELCEELTSQKSQQEVRRALKDYEQKIERLRKCASEIHMTLQPTLGGTSKNKG
TTDASKNGGGNTLSEVPSAKSDNQPSAEKAMELVQNFHLESKLKLQQEESIMEKYEKGHS
TSIDSLLERYDTHKGTLELYLQNSIARITSDFSSDKERSSVCLQDKLTDLQVLKNETDAC
WKEFEITSLKLEELESDIKKPFIVKARDKLKEKERELQMALKSRMESLETVLKMVLPMEK
ESLLLCDTDLLLREMAIQEFHLTDADDIYQNLRNIQDSVVKQIETCKNLGQSGNFALKEL
HPLDLHAAQNIILKHRTQLEEMNHRVQKSKDALEALEDFLASLRAAELSSELLTDHSASD
SQGVPANTLTVENKEREIHRMRDKARHLDEHLKMLGISIKDSEQGENTSCEKLLDALSKN
LSETRSGGQEEVTEEDKLLGACVSKNDELLKNIQDVHNQISKIGLKDPTVPAIKQRRKSL
IRLDKDLDEYEEEKKHLQEMVNSLLQFKDGRNKALSQRCQDTAVLWENVKTLVTECLDQC
ERVLELLKQYQNFKSVLTTLIQKEENVLSVQASYMGKENLKKRIAEIEVVKEEFNEHLEV
VDKINQICKNLQFHLNKMRTFEEPPFEKEANIIVDRWLDINEKTEDYYENLGRALALWDK
LFDLKNGIDEWTEKVLQKLELHQLTEEEREKLKEELQVHEQKPSEFSKRVAKIQFLLQSS
EIPLELQVMESSILNKIERVKMCLMGGSHCGAISGSTAELREDLDQAKTQIGMTESLLNA
LSPSDSLEIFTKLEEIQQQILQQKHSMILLENQIGCLTPELSELKKQYESVSDLFNTKKS
VLQDHFSKLLNDQCKNFNDWFGSIKMNLKECFEPSETKKCVEQKLQKLSDFLTLEGRGSE
IQQVGTVLNHVKKHLPKAPVKKLNSWIVSQEVELEKMESICQARAKELEECLQQLLRLHN
DHRNLSKWLTNQEEIWKEMEGTREKTELFCQAVARKREQFESMAQLNNSVKQYGITEEEE
IVTESTHLIDRYQTLLRQICETDKEDKLPPAEDQSFNDLAHDVIHWITGIKESLMVLNSS
EGKMPLEERIHKIKEIILLKPEGDAKIQAIMSQAESSKTPVVPQTLTDIKNQWDNTLHLA
NTYLSHQEKLLLEGEKYLQSKEDLRLMLTELKKKQEVGFALQPGLQEKKAQLKIYKKFLQ
KAQDLTFLLEELKSQGNYLLECTKNPNFSEEPWLEIKHLHESLLQQLQDSVQKLEGHVQE
HDSYQLCITDLNTALDYIAKEFVCFSDRPVDERVVEEKLQKLQDLENSLHLQDGPLEKIL
TLAKSVKQNTSSAGQKIIKDDIKSLKCKQKDLENRLASAKQEMENCLNSILKSKCSTENK
AKFPLPGREEQVTSDVQESTQDSAAMEKLEEDWEINKNSALEMILSRQLSLDVQESMKNT
EDEQKVNELQNQPLELDVMLRNEQLKEIEELCTQLEGKKAAIEPLEQSEYLSKTESSALV
LHDESYSVQHLDNLLQALITLKKKKESQYCLLEDFQGHLMAGESSMKALLTEKESLKVGL
LDSTTYMDKIKNFLASIEKEKDSLSKMKIEWENLSNCLTDMDKKLLESQIRLLEHGWEQM
KQLAQKKYSQQSVGHEEFMFLMSKIQDLETSLQQQQQHLQLRLNSPEAQEGNLSVVALAT
ELHTIKHRFSMLKGRAELQMKRIWGEKERKILEDAISNLQKQLEALEPLNMEVENQIKKC
ETRYKIKEAILWVQNLLGELTPPISLLPDDVLSQIRKCEVVHDGILAKQQVVESLVEEVK
DNIPNFTAYESNDFNNLLQDLQNQYQMLALKSTQRSQQLELKLEERSKFVAIIGKVQLSL
QGNETLIIPKTDTTSTEAELEQLYVALTTSQKELQEIKSVISTHLQEQTNISKDLSVFER
LFLDDRLKNLKTRANRTQRFIQNKCNEVEHKINFYREFHEKISALQKEFDHIQHNELLLN
PEVNPDVKEELYHLKNQITGIQSSILQVLKLKEVFDCIELNWDWTQLDQIQTQVLEKERE
LEEKIKQLNTFVAEYDKYQASLAKLKALDLQIKKRAEPVLTMPNTPPESSLLNAQVLNQR
IDFDDLFKEREIQQLKLYAEEHNKLRQVLQQKMALQSQLKEMDEKDFKDKLENSLHVLNQ
IKSQLQQPLLINLQIEYIQNEKDNCEVFQEKVQAEMDSIKAVTVIEKQSEENSSEASVVE
AKLNDIEDLYMQLNASIDSRTSVLNDAYENMTRYNEAVSRAMGIISDLETIIVSHRVDLD
NPKESVEVPRQKQEELKSTIAGIQDLTENLGTVSSLEAKRQLECTLQDLVSKNSALREAA
KVKEAEVERCLDNYKRYRNINEKICTNLSQMETILGQSMCPLPVSYKEALERLEQSKALV
SNLMSAKEELLKQRQVLRHLRAMCTDSDSLCLLRSTSALWERWLSLLEAAKEWEMWCEEL
KQEWKFVHEEIEREVIILDNLQEEVPEISKAKEAASTEELLGLLDCLRQYEENVEQQQLL
LALLLQRIKNIQSTPESLGAVESVPASQEIMSMQERCHKLLQKAQKNKELMQNEIQERHS
FTKEITTLKNLFQQTTISFQNMELQDCPEKAEQLEELQSILKKGKLTFENIMEKLRIKYS
EMYTIVPAEIESQVEECRNALEDVDEKISNEVLKSSPSYTTSRKIDEINNGLRNVEKMLQ
QKSKNIEKAQEIQKKMWDELDLWHSKLNELDSEVQDIVEQDPGQAQEWMDKLMIPFQQYQ
QVSQRAESRTSQLNKATIKMEEYHDLLKSTEAWIENTSRLLADPADYDSSKTLSHHASTL
QMALEDSEQKHTLLHSVFTDLEDLSAIFETDDLAQSIQELSHQVAALQQRIIESLPQIQR
MADDVVAIETEVKSMEKKVSKIKAILLSKEIFDFSPEEHLKHGEVILENIRPMKKTIAEI
VSYQVELRLPQTGMKPLPVFERTNRLLQDIKLLENVTQEQNELLKIAIKQTNECNEEMEK
LKQILNNYPAEFSHEHMSTDQAANLSQVQGEIEGMEKQILSLNQKKEDLVVDLKAAILNL
HQHLQQKQQELEQEVLSVGASEENTGAEKDASEWKLNRTSSMSFLPALEEEAEESSLKSE
SGDKKAEPSSGFLSLLWKHDKDVEEDRASSSSGTIIQEAAGKISTCDSSMAQVLEPDLLN
TERGPEFSLSPNQTPEGATPPIKAAATGLSDEQGAFEATVEKVRPEPAEVLHVCKNQVAE
LELWLHQANVAFEPETLDADMQQVVEQQLVGCQAMLTEIEQKVASLLENCKDQGLGDSGA
TQQEAEALSLKLKTVKCNLEKVQMMLQEKYSEDQYVLSLKKYTYVLDIGEINSLDELKNV
LQHSTTLKRQKDFQQQQVLELKPMEQKDLIKFIEFNANKTWPQYCQHDKDTTQTSSARSS
KTSSPQNDAPDLILSTQGQSGDKWQYLHHELSSKIRLPLSQLVQPQVTTNMSILPSVTVY
NFRYPTTEELKTYTTQLEDLRQEANNLQAQENTSEETYTNLDKKLFELFQTLLQCLGSVE
DMLQTPGLFRGDVGTQQVHYETLALELKKLYLAMSDKKNDLSKAMTWPGKNASQFLDCFD
NLQVYLEHTQATAASRSKALKAGLDYTHSYQNEIKRLYDQLVKNKTSLQQSLNEISGQTI
DEQLQKVDAYTVELQNSESRVAKLRDEGERLHLPYVLLQEVYKLEDVLDSMWGLLRARYT
ELSCPFITESQQDALLQGMVELVNIGKEKLAHDHLQQTKSKVALQAQIQNHKLFFQKLVA
DMLLIQTYSNKMLPSLMQKKETFGAEQVKEVKLLEEKSHQYGIKLQSLLQKWEEFDENYA
SLEKDLEILMSTLPSVSLVEETEERLVERISYYQQIKRNLDEKHARLYQTLNEGKQLVAS
VNCPELEGQIAKLEEQWLSLNKKIDHELHRLQTLLKHLLSYNRDSDQLTKWLESSQQTLN
YWKEQSLNVSQDLDTIRSNINNFFEFSKEVDEKSSLKTAVLSTGNQLLHLKEADTATLRA
SLAQFEQKWTGLITQLPDIQEKLHQLQMEKLPSRKAIMEMIDWMNNVEHQTEDEDSEHSL
SSASQVKNLLQKYKEFRMEMDYKQWIVDFVNQSLLQLSTCDVESKRYERTEFAEHLGEMN
RQWQQVHGALNGKIQHLEQLLESITENENKIQILNNWMEAQEERLKTLQKPENVISVQKT
LLDCQDIENQLAMKSKALDELRQNYLTSESGTVPLLEDTASKIDELFQKRNNVMNQVNEL
KTSMQSVLQEWKIYDKLYDEVNMMTIRFWYCMEHSKPVVLSLEALRCQVQNLQTLQDEAE
SSEGSWKKLQEVIGKLKEYCPSVAEIIQEKCQNTHTRWTQVNQDIADQLQRAQSLLQLWQ
ACSSAHAEAAARLEPQETKWQQLANINTSGNNLAEVLPPALQGAKELQCEVQKTKEAFLQ
NSTLLDRLPQPAEPNTHVLLSSQMHSLQRASYLEKMLLVKTNEFEFVLSQFKDFGDRLES
LKGLITHEEENLDKLYRQEKEGNPDLFLNHVLALTAQSPDIEHLNEVSLKLPLSDVAMKT
LQNVNRQWIRATATALERCSELQGIGLNEKFLHCYEKWVQLLQKIEETLKANMADSLPAL
LEQQKTYEMLEAEVSINQTIADSYVTQCLQLLDTAEIEKRPEFVWKFTRLKGQWQSAAQG
VRQRKSDIDELVRQWRSFTTSEGDLLRFLADTSHLLSAVKSQDCHSLHQTRSLIHELKNK
EIHFQRWQTTYALTLEAGEKLLNTANLETKESVNKRISQLQDNWKDTKLQLGEMIKRFQS
TAETWDQCEKKIKELKNRLHVLKAQSKDPLPELHEELHREKELIKELEKSLANWTQNLKE
LHTMKTDLTQHILVDDVMVLKEQIEHLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNK
ELCAWLVQMENKVLQTADISIEEMIEKLQKDCMEEINLFSENKLQLKQMGDRLIKASNKT
RAAEIDDKLNKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSK
PVVYDVCDDQEIQKRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQ
QTTRSLDRRWRNICAMSMERRMKIEETWRLWQKFLDDYSRFEDWLKAAERTAACPNSSEV
LYTVAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWD
NLQKRVTAILRRLRHFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDADDKMRQLN
GFQQEITLNTNKIDQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRL
TSHAPGLEDEKEASENETDVEDPREIQDDSWRKRGASEEPSSPQSLCQLVPPALGPERSG
CETPVSVDSIPLEWDHTGDVGGSSSHEEDEEGPYYSALSGKSISEGPSWHVPDSPSCPKR
RYKQMGGDRNVQPIPSDSSTPYKPAYVKLLLSPGTEGGKEDPGVLTGSAQQEDEDLAALT
GQQSGAFDRWELIQAQELHNKLRKKQNLQKLNSDISNITPWLEKTGAELETLKLAEPPSD
MQEMELQVKKLKEILKAFDTYKALVVSVNVNSKEFLQSESAESKELQGRVGQLTLRWNTA
LGAVESWREGLRRSLMQCQDFHQLSQSLLLWLASAESRRQKAHVTDPEADPQALLACQEE
LVQLEKELVERQPQVNSLQEISSTLLIKGHGEDYIEAEEKVHVIEKKLKQLLEQVSQDLV
SLQRSQNPDSPLPSVDEVDHGEPLAASAPAPQAKFEAEKTTKEKNKTASRVPGPAAPESS
KPQRSFLSRVFRAALPLQLLLLLLLFLACLLPSSEEDYSCTQANNFARSFYPMLRYTNGP
PPT
Download sequence
Identical sequences F1MF78
ENSBTAP00000029285 ENSBTAP00000012582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]