SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012611 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012611
Domain Number 1 Region: 337-509
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 6.81e-46
Family Cell cycle control phosphatase, catalytic domain 0.0000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012611   Gene: ENSBTAG00000009586   Transcript: ENSBTAT00000012611
Sequence length 525
Comment pep:known chromosome:UMD3.1:22:52242566:52264187:1 gene:ENSBTAG00000009586 transcript:ENSBTAT00000012611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGPEPPHRRRLLFACSPPPAPQPVVKALFGTPAAGGLSPVTNLTVTMDQLQGLGSEYE
QPIEVKNSSLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRINSLPQKLLGCSPALKR
SHSDSLDHDVFQLIDQDENKENQVFEFKKPIRPASRGCLHVHGLEEGKDVFTQRQNSAPA
RMLSSNERDGNEPGNSIPFMPQSPVTPTLSDEDDGFMDLLDGENLKNDEETPSCMASLWT
APLVMRRTNNLGNRCKLFDSPSASCSSTIRSMLKRPDRSLEESPGGSRKRRKSVAGASPE
EAASPEKPQEILHHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKY
ISPEIITSVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEEFLLKKPIVP
TDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQS
HCEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
Download sequence
Identical sequences A7MBD1
ENSBTAP00000012611 ENSBTAP00000012611 NP_001094570.1.59421 NP_001094570.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]