SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012662 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012662
Domain Number 1 Region: 155-241
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.38e-34
Family SCAN domain 0.0000542
Further Details:      
 
Domain Number 2 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 556-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-21
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 5 Region: 273-325
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 478-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012662   Gene: ENSBTAG00000013353   Transcript: ENSBTAT00000012662
Sequence length 620
Comment pep:known chromosome:UMD3.1:18:65732473:65755773:1 gene:ENSBTAG00000013353 transcript:ENSBTAT00000012662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGLPTDWFREPVTFEDVALGFTPDEWGKLDLEQKSLYREVMLENYRNLVSVEHQLSKP
DVVSQLEEEEELWSVERGIPQDTFSECPEAQLEPQLDPFPAGNPLMNIEVVEVLTLNQEV
AVPRNAQIRALYAEDEGLSPEVLREPPQHLDKPTADPEMARQRFRGFHFEEVAGPREALA
QLRELCCQWLRPEAHSKDQMLELLVLEQFLGALPEKLRLWVESQHPVDCRQAVALVEDVT
WISEEETLPTQGAPGTLPPAAQQDTATWPVKALPEDPVTFLDVAVDFSTEEWGLLDPTQR
TEYHDVMLETFGHLVSVGWETTLDSKQLTPQPGPPEEGPACPLKEEEGSSADDARPSTSG
EALEAGAPGVWDTALKPVTLASENTLPPQPPGDSPQPQASTGPDRGRVSLQKAVPRKRLR
KRDPWLKRGTRGACVKLPPKRGGAGKAVESGGDGGRRPCARNAPQITFTRIHKGSQVCRC
SECGKTFRNPRYFSVHKKIHTGEKPYVCRDCGKAFVQSSSLRQHQRVHTGERPFVCHECG
RTFNDRSAISQHLRTHTGAKPYPCPDCGKAFRQSSHLIRHQRTHTGERPYSCSKCGKAFT
QSSHLIGHQKTHSRVKCKKK
Download sequence
Identical sequences A6QPT6
ENSBTAP00000012662 NP_001094623.1.59421 NP_001094623.1.76553 XP_010813875.1.76553 ENSBTAP00000012662 9913.ENSBTAP00000012662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]