SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012674 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012674
Domain Number 1 Region: 93-259
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0057
Further Details:      
 
Domain Number 2 Region: 239-354
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.57e-23
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 470-539
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-19
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 4 Region: 560-592,626-714
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000575
Family RUN domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012674   Gene: ENSBTAG00000009624   Transcript: ENSBTAT00000012674
Sequence length 747
Comment pep:known chromosome:UMD3.1:5:112226838:112260854:1 gene:ENSBTAG00000009624 transcript:ENSBTAT00000012674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSHVPSANGPFSALTPSMWPQEILAKYAQEEATVEQPEFRYDEFGFRVDKEDADGIPY
SGQLLEDPPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGVPHSMRPQL
WMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFAHVSGVGVPR
LRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEDDAFWMMCAIIEDLLPASYFSTTLLG
VQTDQRVLRHLIVQYLPRLDRLLQEHDIELSLITLHWFLTAFASVVHIRLLLRLWDLFFY
EGSLVLFQATLGMLRLKEDELIQSENSASIFNTLSDIPSQLEDADLLLAEAMRLAGSLTA
VAVETQRRKHLAYLLADQGQLLGAPATTGLSQVVRRRTQRRKSGITSLLFGEDDLEAMKA
KNIKQTELVADLREAILRVARHFQCTDPKNCNVELTPDYSMESHQRDHESYVACSRGHPR
RAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDERSKE
YSIAGDDAVTEGVTDLVRGTLCPALKALLEHGLKKPSLLGGACHPWLFIEEAAGREVERD
FDSVYSRLVLCKTYRLDEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLN
EQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPAKR
EEEKKPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences Q2KI13
ENSBTAP00000012674 NP_001070013.1.59421 NP_001070013.1.76553 ENSBTAP00000012674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]