SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012691 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012691
Domain Number 1 Region: 328-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 407-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000108
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012691   Gene: ENSBTAG00000009631   Transcript: ENSBTAT00000012691
Sequence length 524
Comment pep:known chromosome:UMD3.1:2:127356739:127362422:1 gene:ENSBTAG00000009631 transcript:ENSBTAT00000012691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGEPAPELGCCHKTKPPGSTGDSLSPNLDSQLCQDGQVFPAFKPHPDTLDPHGQSWASW
LCPWPLAPAKSALLACPQGLDLYLCALQSATLATAPRGLREDALSARHLPPRLPAGFFSD
EKLPAKCPLSRDKMGSQTERAGEGAPCPSFSPPNSSSPNSWQNKKSPLAFCSCPPTPPNS
KELSSHFCPFYPAYPFFLPAPYLVTYGSLPSVPCAPRFKLPQDTPYATKAVPSLLINVNE
SEHPSTWEETLHSYPGACQDSGQTQPSQSQNPGPAAARTYSMGPERAGRAAAGKRAPLGS
QAGSAALPYPLKKENGKILYECNVCSKSFGQLSNLKVHLRVHSGERPFQCALCQKSFTQL
AHLQKHHLVHTGERPHECPVPDTVVPGRNHGGKLPGLHHREMCHKRFSSSSNLKTHLRLH
SGARPFQCSVCPSRFTQLVHLKLHLRLHAPRPCGLAHTHLPLASLTYLARWHQGALDILA
APSERQMDRDMDKVKVSSASQGNSAGGDFTSHSTWQVMGHSQEE
Download sequence
Identical sequences F1MR18
ENSBTAP00000012691 ENSBTAP00000012691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]