SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012706 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012706
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily POZ domain 4.45e-23
Family BTB/POZ domain 0.0071
Further Details:      
 
Domain Number 2 Region: 229-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000607
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 3 Region: 345-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000775
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012706   Gene: ENSBTAG00000009643   Transcript: ENSBTAT00000012706
Sequence length 435
Comment pep:known chromosome:UMD3.1:10:76943981:76960818:-1 gene:ENSBTAG00000009643 transcript:ENSBTAT00000012706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSEC
IKIQPTDIQPDIFSYLLHIMYTGKGPKQIVDHSRLEEGIRFLHADYLSHIATEMNQVFSP
ETVQSSNLYGIQISTTQKTAVKPGLEVKEAPSNNNGNRAAVQGDHPQLQLSLAIGLDDGS
ADQQRAHPASQALEEHQKPPVSIKQERCDPESVISQSRPSPSSEVTGPTFTESGIKIHLC
HYCGERFDSRSNLRQHLHTHVSGSLPFGVPASILESNDLGEVHPLNENSEALECRRLSSF
IVKENEQQPDLPNRGATEPLQISQVSLISKDTEPVELNCNFSFSRKRKISCTICGHKFLR
KSQLLEHMYTHKGKSYRFNRCQRFGNALAQRFPPYCDSWSDIPLKSSRLSQEQLDSSCAL
ESELTQENVDTILVE
Download sequence
Identical sequences E1BFH3
9913.ENSBTAP00000012706 ENSBTAP00000012706 NP_001157495.1.59421 NP_001157495.1.76553 ENSBTAP00000012706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]