SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012722 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012722
Domain Number 1 Region: 1291-1431
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-53
Family Phosphotyrosine-binding domain (PTB) 0.00000178
Further Details:      
 
Domain Number 2 Region: 173-301
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.14e-38
Family PLC-like (P variant) 0.001
Further Details:      
 
Domain Number 3 Region: 7-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.16e-29
Family Dual specificity phosphatase-like 0.00018
Further Details:      
 
Domain Number 4 Region: 1151-1285
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-24
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012722   Gene: ENSBTAG00000009655   Transcript: ENSBTAT00000012722
Sequence length 1437
Comment pep:known chromosome:UMD3.1:4:75451285:75567973:1 gene:ENSBTAG00000009655 transcript:ENSBTAT00000012722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGRELDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLRSKHGDNYLVLNLSEKRYD
LTKLNPKILDVGWPELHAPPLDKVCTICKAQEAWLNSDPQHVVVIHCRGGKGRIGVVISS
YMHFTNVSASADQALDRFAMKKFYDDKLAALMQPSQKRYVQFLSGLLSGTVKMNASPLFL
HFVILHGTPNFDSGGVCRPFLKLYQAMQPVYTSGIYNVGPENQSRIYIAIEPAQLLKGDI
MVKCYHKKYRSATRDVIFRLQFHTGAVQGYRLVFAKEDLDNASKDDRFPDNGKIELVFSA
TPEKIQGCEHLQNDHRVIVDFNTADPLIRWDSYENLSADGEVLHTQGPVDGSLYAKVRKK
STSDPSVPGGSPAVPAASSPDHSDHTLSVSSDSGHSTASVRTDRTEEHLTPGSKRGLSPQ
EKAELDQLLSGFGLEDSGSPLKDMSDARSKYSGTRHVVPAQVHVNGDTTPKDRETDILDD
EMPSHDLHSVDSIGTLSSSEGHPSAHLSPFTCHQSSQNSLLSDGFGSTAGEDQHGALAPD
LGLAAEPLFERERAFGSCEPKQPQPVLRKPSVPAQTQAYGPSSYSTQTWVRQQQMVAAHQ
YSFAPDGEARLSGRGAADSSGLLQTQPRVPLTPTRGASSRVAVQRGIGPGPHPPDIQRPP
PGKAAFKPRIPDVKVVNGAGPELGTDLSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTH
MNMSSSQANGPMPPDGMAGGLWASGRLQDTGDGPGRAPVRQGDEPLGGRFRKLSLEQYDN
EAGEQPTFSKCSWGKTTSSEQTPGLAPFLSPDNTKEAVITTYPPDLDVIDGRIFSPTNSG
SESISPTPAFPVSPETPYGTTSPRYSPFSPSVPQMGSPSALYKGAHEPRGCPEILSHSVG
MSESPVGPKPTMLRADMPTAPSFQRAFTSSCTISGNSPSQRRGSPSSAEHQWVETSPKST
LTLLGGSRPGKDSPARPHFPPADLQTSFHGPELSLAEPPEALGPPSNHAFLSFSTAPMAG
GGLPAGEDPGALLANSHGAAQAPGNPLTAAEAADNSFLSHSFLTVAPGHSGHHSPVLQGP
GLALPGQPPLPEKKRTSEGDRSFGSVSPSSSGFSSPHSGSTMSIPFPNIIPDFSKAAEGA
APSPDNPGDKHVSVNFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGAYGL
AMKVATPPPSVLQMNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHS
ITPLALPCKLLIPDRDPLEEIAENPQQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQ
AIQKALSMTLVQEPPPLSTVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCALDPQDR
KWVTDGPCSRVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSPKKI
Download sequence
Identical sequences E1BFE8
ENSBTAP00000012722 ENSBTAP00000012722 XP_005198148.2.59421 XP_005205669.1.76553 XP_015318560.1.59421 XP_015318561.1.59421 XP_015325529.1.76553 XP_015325530.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]