SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012783 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012783
Domain Number 1 Region: 445-639
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0041
Further Details:      
 
Domain Number 2 Region: 615-726
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.22e-24
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012783   Gene: ENSBTAG00000009693   Transcript: ENSBTAT00000012783
Sequence length 761
Comment pep:known chromosome:UMD3.1:26:15754511:15850136:1 gene:ENSBTAG00000009693 transcript:ENSBTAT00000012783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGPEDAGGCSARNPKLLLLPAPDSAGLDGKMIRATGGFGGGVGAVEPPEEEEEEEETPP
PQQLLQRYLAAAGGQLEPGLCYCPLPAGHSCAPPPSAASRSDACQPDAGSKHRDAEAADA
GSARHGGMTNGDSGFLLGQDCRDLARAGSREPCHRRLRPDGPGDEGADGAGILSDWAAPL
EDPLRSCCLEAADPEEPEGEGSGVRDSSASDGSGSEDLERLGAGAGGSEEAASPVTSAER
TSGGAGAEPRVGFSDVHWNSRNTFEVSRCQSARDHLPPAGAPVSLPAAEEGLAGTSARAR
RSGGFADFFARNLFPKRTKELKSVVHSAPGWKLFGKVPPRENLQKTSKIIQQEYEARIGR
ACKPPPQSSRRKNFEFEPLSTTALILEDRPSNLPAKSVEEALRHRQEYDEMVAEAKKREI
KEAHKRKKIMKERFKQEESIASAMVIWINEILPNWEVMRSTRRVRELWWQGLPPSVRGKV
WSLAVGNELNITPELYEIFLSRAKERWKSFSETSSENDVEGVSVADREASLELIKLDISR
TFPSLYIFQKGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFAN
LLNKPCQLAFFRVDHSMMLKYFATFEVFFEENLSKLFLHFKSYSLTPDIYLIDWIFTLYS
KSLPLDLACRVWDVFCRDGEEFLFRTGLGILRLYEDILLQMDFIHIAQFLTKLPEDITSE
KLFSCIAAIQMQNSTKKWTQVFSSVMKDIKEGDNNSPALKS
Download sequence
Identical sequences F1MRD8
ENSBTAP00000012783 ENSBTAP00000012783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]