SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012786 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012786
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-82
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 233-355
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 469-590
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-31
Family Spectrin repeat 0.000000586
Further Details:      
 
Domain Number 4 Region: 356-464
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-24
Family Spectrin repeat 0.000000886
Further Details:      
 
Domain Number 5 Region: 594-705
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-22
Family Spectrin repeat 0.000000565
Further Details:      
 
Domain Number 6 Region: 698-826
Classification Level Classification E-value
Superfamily EF-hand 3.89e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012786   Gene: ENSBTAG00000009696   Transcript: ENSBTAT00000012786
Sequence length 853
Comment pep:known chromosome:UMD3.1:28:9403202:9450916:1 gene:ENSBTAG00000009696 transcript:ENSBTAT00000012786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVN
KALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWC
QRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEK
HLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENER
LMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQL
EINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERVEH
LAEKFRQKASTHETWAYGKEQILLQKDYESSTLTEVRALLRKHEAFESDLAAHQDRVEQI
AAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEF
AKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSILAIQNE
VEKVIQSYSIRISSSNPYSTVTVDEIRSKWDKVKQLVPIRDQSLQEELARQHANERLRRQ
FAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQL
IQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRAS
FNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRE
TADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDY
TAFSSALYGESDL
Download sequence
Identical sequences F1MRD4
9913.ENSBTAP00000012786 ENSBTAP00000012786 ENSBTAP00000012786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]