SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012855 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012855
Domain Number 1 Region: 302-415
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-34
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 146-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-33
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 3 Region: 467-579
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.45e-28
Family Frizzled cysteine-rich domain 0.00028
Further Details:      
 
Domain Number 4 Region: 260-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000101
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000012855
Domain Number - Region: 424-455
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000327
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012855   Gene: ENSBTAG00000009748   Transcript: ENSBTAT00000012855
Sequence length 582
Comment pep:known chromosome:UMD3.1:15:30450602:30455935:-1 gene:ENSBTAG00000009748 transcript:ENSBTAT00000012855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDCSDIVLCVETTELSKTEFCNPAFEPESGPPCPFPALREDADCSAPAPWHGRHPRRLQ
PDCRFSWLCVLLLAGLLLLLLGLLVAIILAQLQATTSPGATYHPLPSRGLATTGTTPATS
TTTSQATGTPKGQPEAGVSLAPQSACGGLLPGPRGFFSSPNYPDPYPPNAHCVWHIQVAT
DHTIQLKIETLSTESVASCLFDRLEISPEPEGPLLRVCGRVPPPTLNTNASRLRVAFVSD
SSVEGSGFHAWYQAVAPGHGSCAHEEFPCDQFVCLLRDSVCDGFANCADGSDEINCSAKF
SGCGGNLTGLEGTFSAPSYLQQYPHQQLCTWHISVPAGHGIELLFHNFSLEAQDECKSDY
VEVYEAHSSGALSLLDRFCGAEPPPRLISSRHQLAVLFRTDHGFSAGGFSATYRALNATE
SRWPWALGPGELSCQDGGCKSPQWMCSTWRDCADDNCSSPLFPPPELACEPVQVEMCIGL
SYNTTAFPNIWVGMTTQEEVVEVLRGYKSLTSLPCYQNFRRLLCGLLVPHCTPLGSVLPP
CRSVCQEAERQCQSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences E1B8U4
ENSBTAP00000012855 ENSBTAP00000012855 9913.ENSBTAP00000012855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]