SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013096 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013096
Domain Number 1 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 368-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 229-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 7 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 3-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-19
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 9 Region: 331-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000737
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 191-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000598
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013096   Gene: ENSBTAG00000003447   Transcript: ENSBTAT00000013096
Sequence length 640
Comment pep:known chromosome:UMD3.1:18:65291985:65319869:1 gene:ENSBTAG00000003447 transcript:ENSBTAT00000013096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGMKFEDVAIDFSQEEWGLLDEAQRLLYYSVMLENFALVASLGCCHGTEDEEAPSEQSLS
VEAESQVGVSKAGPSIQKIHPCEMCVPILKDILHQETRLGGTCLRHFCSSADFHWQHRDD
SGEKPWERDVERVSFVRSCHLFVSGKPFTDTGVGEDCPATLGLLQHQATINNEESQSGRK
SGQAFHSEKSHYKWGECEKVDSHNHNLVQDQSVCSKERLYQCNKCSKGFNCNYRLVQHQQ
IHTGQRPYECGECGKSFSRKFVFIEHQRVHTGERPFECTECGKSFIQKSELIQHQRIHSG
TRPYECSECRKSFRQHSGLIHHQRIHSGEKPYECNERGKSFSQNASLIQHQRVHTGGKPY
ECNECVKSFSRSDSLIQHQRGHTGERPYECSDCEKSFSWKSSLLRHQRVHTGGEKPYECG
ECGKSFRQSSSLIQHRRVHTGARPHECDECGKLFSNKSNLIKHRRIHTGERPYECSECGK
SFSESSALLQHRSVHTGERPYECSECGKFFTYHSSLIKHQRVHSGSRPYECNECGKSFTQ
NSSLIEHRRVHSGERPYKCSECGKSFSQSSALLQHRRVHTGERPYECNECGKFFTYSSSL
LKHQRVHTGSRPYECSECGKSFTQNSSLIKHRRIHTGERP
Download sequence
Identical sequences F1MVL7
ENSBTAP00000013096 ENSBTAP00000013096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]