SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013117 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013117
Domain Number 1 Region: 405-714
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.05e-120
Family Mammalian PLC 0.000000275
Further Details:      
 
Domain Number 2 Region: 245-404
Classification Level Classification E-value
Superfamily EF-hand 1.08e-40
Family EF-hand modules in multidomain proteins 0.0094
Further Details:      
 
Domain Number 3 Region: 734-859
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-30
Family PLC-like (P variant) 0.00028
Further Details:      
 
Domain Number 4 Region: 116-229
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-29
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013117   Gene: ENSBTAG00000009942   Transcript: ENSBTAT00000013117
Sequence length 1106
Comment pep:known chromosome:UMD3.1:1:155618262:155833445:1 gene:ENSBTAG00000009942 transcript:ENSBTAT00000013117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPSSPGPVLAAKGALRAGAGEGGGGGRPGPGRARCDSAGVSNGDCSLGAPGGEARVGPAL
AAAPGPAACPLPRDSKPGGLPRRSSIIKDGTKQKRERKKTVSFSSMPTEKKISSASDCIN
AMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTD
IFRSNGVSDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLISYGKHTLDMLE
SSQDNMRTSWVSQMFSEIDVDDLGHITLCSAVQCIRNLNPGLKTSKIELKFKELHKSRDK
TGTDVIKEEFVEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEIS
LEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSH
NTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVID
IINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKILGDKLYTTSPNVEESYLPSPDVL
KGKILVKAKKLSSSCSGVEGDVTDEDEGAEMSQRMGKENTEPANHVPAKRFQLCKELSEL
VSICKSVQFKEFQASFQAQKYWEVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMR
IDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNVGWFRQNGNCGYVLRPAIMREEVSFFS
ANTKDSVPGVSPQLLHIKVISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTRT
VHQNGDAPIFDESFEFQVNLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVQL
QSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFK
NAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNLS
EQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLQS
IGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETVENLKQIHYAAVSCGLNKPG
TENADVQKPRRSLEVIPEKANDETGE
Download sequence
Identical sequences E1BH60
ENSBTAP00000013117 ENSBTAP00000013117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]