SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013136 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013136
Domain Number 1 Region: 525-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000012
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000021
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 217-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000605
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 189-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000385
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number 5 Region: 488-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000879
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013136   Gene: ENSBTAG00000009961   Transcript: ENSBTAT00000013136
Sequence length 781
Comment pep:known chromosome:UMD3.1:25:1753636:1762994:1 gene:ENSBTAG00000009961 transcript:ENSBTAT00000013136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAMAVRVTAAHTAEARAEAGREAGEGGVAAAAAALAPGGFLGLPAPFSEEDEDDVHRC
GRCQAEFTALEDFVQHKLQKACQRAPQEALPATPAAALLGREVAPGAASSEEPITVAHIV
VEAAALAGDINHSPDIVGGGHIKEVIVASEAEPGDSEMAEGPGSSSERGPRLAAEGEQAQ
VKLLVNKDGRYVCMLCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRR
HTDERPYKCAKCGKSFRESGALTRHLKSLTPCTEKIRFSMSKDVVVGKEDVPAGSGASTV
GPVTPSSAGEPMETSPVIHLVTDAKGTVIHEVHVQMQELPLGMKALAPEPTSPQELPCSS
EGGRENLLHQAMQNSGIVLERAPGEEGALGPATPTASSPQSPGDAAPELPLLEVEQAETQ
VAGEASSVPRTHPCPQCSETFPTAATLEAHKRGHAGPRPFTCPQCGKAFPKAYLLKKHQE
VHVHERRFRCGDCGKLYKTIAHVRGHRRVHSDERPYPCPECGKCYKTKNAQQVHFRTHLE
EKPHVCPFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLE
VEELLVSEESPTAAAAVLTEDPHTVLVEFSSVVADTQEYIIEATADDAETSEATEIIEGT
QTEVDSHIMKVVQQIVHQASAGHQIIVQNVTMDQEARLGPEAAAADTITIATPESLTEQV
AMTLASAISEGTVLTARSGTGGAEQATVTMVSSEDIEILEHAGELVIASPEGQLEVQTVI
V
Download sequence
Identical sequences E1BH42
ENSBTAP00000013136 ENSBTAP00000013136 9913.ENSBTAP00000013136 NP_001192754.1.59421 NP_001192754.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]