SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013535 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013535
Domain Number 1 Region: 34-207
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-43
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 186-303
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013535   Gene: ENSBTAG00000010246   Transcript: ENSBTAT00000013535
Sequence length 328
Comment pep:known chromosome:UMD3.1:12:90622564:90639777:-1 gene:ENSBTAG00000010246 transcript:ENSBTAT00000013535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIDPYGFERPEDFDYAAYEEFFSTYLVILTRRAIKWSKLLKGGGGVQRSMTVKRYIRKGV
PLEHRARVWMGVSGAQARMDRNPGYYQRLLQGERSASLEEAIRTDMNRTFPDNVRFRKDA
EPCLQGPLYNVLLAYGHHNHGVGYCQGMNFIAGYLILVTKSEEEAFWLLDALVGRILPAD
YYSPSMLGLKTDQEVLGELVRTKLPAVAALMHSHGVLWTLVASRWFICLFVDVLPVETVL
RVWDCLFSEGSKIIFRVALTLLKHHQASILEATSVPDLCEKFKEITRGRFVTECHSFMQR
IFLEPGSLSRASIARLRERCRARLLAQG
Download sequence
Identical sequences F1MIH5
ENSBTAP00000013535 ENSBTAP00000013535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]