SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013588 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013588
Domain Number 1 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 602-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.7e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 438-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 7 Region: 643-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 242-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-18
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 9 Region: 494-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000103
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 344-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000472
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013588   Gene: ENSBTAG00000010291   Transcript: ENSBTAT00000013588
Sequence length 713
Comment pep:known chromosome:UMD3.1:25:39080280:39089918:1 gene:ENSBTAG00000010291 transcript:ENSBTAT00000013588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESQGSVSFRDVAVDFTQEEWQQLDPEEKMTYRDVMLENYSHLVSVGYDSTKPNVIIKL
EQGEEPWVVDSKFLQQQHSEKVWKVGDLIERIQENGDECSRQAVSINSRTLTEEREDAFD
KTYNVETSLAPLNLTSYNCISCGKTLESTSELIISDGSYARKKPDECNECGKMYGEKLYE
FHQNGEACSQNEESIQKISILEKPFEYNGCTEALDNEAVFITHKSTYMGEKCYEWNDSRP
DFIQMSNFNIYQRSQMDLKPFECRECGKSFCKKSKFIIHQRAHTGEKPYACTVCGKSFSQ
KGTLTVHRRSHLEEKPYKCNECGKTFCQKLHLTQHLRTHSGEKPYECNECGKTFCQKTHL
TLHQRNHSGERPYPCSECGKSFSRKSALSDHQRTHTGEKLYKCNECGKSYYRKSTLITHQ
RTHTGEKPYQCSECGKFFSRVSYLTIHYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHT
DEKPHECSECGKLSHLTSLHTTHLGEKPYECSECGKTFLENSAFNGHQPLPTGEKSYECN
ICGKVFSELSYYTIHYRSHSEEKPYGCNECGKTFSHNSSLFRHQRVHTGEKPYECYECGK
FFSQKSYLTIHHRIHSGEKPYECSKCGKVFSRMSNLTVHYRSHSGEKPYECNECGKVFSQ
KSYLTVHYRTHSGEKPYECNECGKKFHHRSAFNSHQRIHRRGNLNVLDMGSLL
Download sequence
Identical sequences F1MHZ4
ENSBTAP00000013588 ENSBTAP00000013588 NP_001178185.1.59421 NP_001178185.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]