SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013601 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013601
Domain Number 1 Region: 385-438
Classification Level Classification E-value
Superfamily EF-hand 0.00000000489
Family Eps15 homology domain (EH domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013601   Gene: ENSBTAG00000010292   Transcript: ENSBTAT00000013601
Sequence length 1384
Comment pep:known chromosome:UMD3.1:19:14125753:14209164:-1 gene:ENSBTAG00000010292 transcript:ENSBTAT00000013601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRPGSGAGGGGAAGAGTGAAGGGSFMFPVASGLRPPQGLMPMQQQGFPMVSVMQPNMQ
GMIGMNYSSQMSQGPIAMQAGIPMGPIPAGGMPYLGQAPFLGMRPPGPQYTPDMQKQFAE
EQQKRFEQQQKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKSRDDALEAIKGNLDGFSR
DAKMHPTPASHPKKPDYPTSSHSTKTVSPSPAFLDEEEFSDFMQGPVEVPTCGPSSTSQP
FQSFHSTTPLGQLHVQKAGAQPLPPGSSLEEKLLVSCDLSTSGQEQIKFNTSEVGHKALG
PGSSKNHPSLMASNGGAVDGRVSGTTTAEAAKTSDQNLCIEESGVGVFPSQDPVQPRMPP
WIYNESLVPDAYKKILETTMTPTGIDTAKLYPILMSSGLPRETLGQIWALANRTTPGKLT
KEELYAVLAMIAATQRGVPAMSPDALNQFPAAPVPTLSGFPVTLPAAVSQPTGMPSGPAG
SMPLTLGQPVMGINLVGPVGGAAAQASSGFMSAYAANQVVKPEDDDFQDFQDASKSGSLD
DSFSDFQELPASSKSNNSQHGNSAPSLLMPLPGTKASASMDKYAVFKGIAADKPSENTVP
FGEPGDKYSAFRELEQTAENKSLGENFAEFRSAGTDDGFTDFKTADSISPLEPPAKDKPF
PATFPSGATQQKPQTQVKNPLNLADLDMFSSVTCSNEKPLSFSAAFSVSKPVSTRPQPAG
SAAPSAALVSTKTAGLADDFGEFNLFGEYSSPASVGEQDDFADFMAFSNSSVSSEQKADD
KYEALKEEASPGPLTSSTGIAGKSGQNSAATSTKYDVFKQLSLEGSGLGGEELKDSTSSG
KSDDDFADFHSSKFSSVNSDKSLGEKAVAFRHTKEDSASVKSLDLPSLGGSSVGKEDSED
ALSVQFDMKLADVGGELKHVMSDSSLDLPTVSGQHPPAADIEDLKYAAFGTYSSSFAVST
LTSSDWSDRDDASQGRKLSPFVLSAGSGASAAASVLQKKETSFGSSENLTVASLSKVTTF
ASEDPLPETTFLPFANFKDVIPQASEPKEYESGDFRDFARQDLPVGERSQEAMCLSPASS
SASHDTPKECTDDFGEFQSEKPKISKFDFLVANSQGKMKSSEEMIKNELATFDLSVQGSH
KRSLSLGDKEISRSSPSPALEQPFRDRSNTLSEKPALPVIRDKYKDLTGEVEENERYAYE
WQRCLGSALEVIKKANDTLNGISSSSVCTEVIQSAQGMEYLLGVVEVYRVTKRVELGIKA
TAVCSEKLQQLLKDIDKVWNNLIGFMSLATLTPDENSLDFSSCMLRPGIKNAQELACGVC
LLNVDSRSRKEEKPAEEHPKKAFNSETDSFKLAYGGHQYHASCANFWINCVEPKPPGLIL
PDLL
Download sequence
Identical sequences F1MI41
9913.ENSBTAP00000013601 ENSBTAP00000013601 ENSBTAP00000013601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]