SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013620 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013620
Domain Number 1 Region: 100-386
Classification Level Classification E-value
Superfamily L domain-like 9.52e-50
Family Ngr ectodomain-like 0.0061
Further Details:      
 
Domain Number 2 Region: 402-711
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-42
Family Rhodopsin-like 0.00049
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013620   Gene: ENSBTAG00000010306   Transcript: ENSBTAT00000013620
Sequence length 759
Comment pep:known chromosome:UMD3.1:17:41318286:41446129:-1 gene:ENSBTAG00000010306 transcript:ENSBTAT00000013620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRPVFLYILIFGKYFAPGRAQNAPCDLGYFPCGNTTKCLPQQLQCNGVDDCENHVDED
NCGDINGWSTQFDRYYGNNYKMTSLYPSIVAETSECLVGSPPMQCICQGLELECDEINLR
AVPSVSSNVTFMSLRRNLIRKLPPNVFKRYHGLQTLCLQNNKIRSVSVYAFRGLYSLTKL
YLSHNRITLLKPGVFEDLHRLEWLIIEDNHLNRISPLTFYGLNSLILLVLMNNVLTRLPD
KSLCQHMPRLHWLDFEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLSENTFAPLQKLDE
LDLGSNKIENLSPHIFKDLKELSQLNLSYNPIQTIQANQFDNLIKLKSLSLEGIEISNIQ
QRMFRPLMNLSYIYFKRFQYCGYAPHVRICKPNTDGLSSLEDLLASIIQRVFVWVVSAVT
CFGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGIYLFVIGAFDLKFRGEYNKHAQLW
MESIHCQLLGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPGKCRTITVLILIWIIG
VIVAFIPLSNKEFFKNYYGTNGVCFPLHSEDAESTGAQIYSVAIFLGINLAAFIIIVFSY
GSMFYSIHQSAITANEIRNQVKKEMILAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPG
TITSWVVIFILPINSALNPILYTLTTRPFKEMIHQFWYNYRQRRSIDSKGSQKTYAPSFI
WVEMWPMQEMPSELMEPVLFADSSELSLISQSTKLNSYS
Download sequence
Identical sequences F1MI30
ENSBTAP00000013620 ENSBTAP00000013620 XP_002694461.1.76553 XP_610789.4.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]