SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013720 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013720
Domain Number 1 Region: 614-821
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-38
Family DBL homology domain (DH-domain) 0.00000627
Further Details:      
 
Domain Number 2 Region: 834-961
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-26
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 
Domain Number 3 Region: 320-424
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000301
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 41-192
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000288
Family CRAL/TRIO domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013720   Gene: ENSBTAG00000010394   Transcript: ENSBTAT00000013720
Sequence length 1112
Comment pep:known chromosome:UMD3.1:1:84324970:84525526:1 gene:ENSBTAG00000010394 transcript:ENSBTAT00000013720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLPCCRSIISPLSLSSKTSTRFTCTDEIMQQEIRPLVAVDIIEQLHRQFAILSGGRGKDG
APIITFPEFVGFKHIPDEDFLNVMTYLTSVPSMEAASIGFVIVIDRRRDKWSSIKASLTR
IAVAFPGNLQLILILRPSRFIQRTFTDIGIKYYRDEFKMKVPIVMLNSVSDLHDYIDKSQ
LTADLGGTLEYRHSQWINHRTAIENFALALKTTAQMLQTFGACLATTELPRSIPSTEDLL
MSHMRQWNKLQDELKLLGKQGATLLSCMQEPATKSPTSKLSLHEVENVATMERLLVQLDE
TQKAFIQFWSEHHLKLNQYLQLQHFEHSFCEVKLALDNLLAEQAEFSDIGDSVMHVEQLL
KEHKKLEGEGQESLEKAQLLAVIGDQLIQSHHYAVDSIRPRCAELRHLCDDFINENKKKH
DILEKSLELHRRLDKVSQWCEAGVYLLASQAVDKYQSREGIDIALNDIETFLGTAKEYQL
PSSKDFYNQYELMLTLDIKTKAQKVLQKLSDVQEIFHKRQMSLMKLAARQTRPVQPVAPH
PESSPKWASPKISQPSTLGELLGELKTSEEPYTETDLNSEEKEDDETKSEVKNEEILESS
HDADNPEPEQPDGSKNLSHSRHIIRDLVETEVTYIKEIKNIIDGYIIPMDFIWLKHLIPD
VLRNNKEFLFGNIRELYEFHSRTFLKELEKCTENPELLARCFLKRKEDLQIYFKYHKNLP
RARAIWQECQDCTYFGVCQRQLGHSLPLFKCLREPSQRLIKYQMLLKGLLDFESPEDLEM
DPSDLEGGSAKNGPKRTKDSTFLADLQQALAMMEDLIKSCELAMDLAAVTGCPDDIGKFG
KLLMHGSFNVWTVHKDRYKMKDLIRFKPSQRQIYLFEREIMFCKIQLEPSDQGLSPHYSF
KKSMKLMTLSIRQLGRGSNRKFEIANQNGLEKYILQAASKEIRDCWFSEISKLLMKQQNN
IKDQGNLQFEASTSKGNEVEFVPWIENMERATGSKEDSVTNTCRSQGCSSREFISMETSV
NCEGAEDLEKENSVLSLSGLFRLDDSYETSTSGQEKGESIRGEKKGCQKKDTATNKTEES
LETSTGLLAPAGKASFPRAEAVRAEAVRAQEG
Download sequence
Identical sequences F1MQ44
ENSBTAP00000013720 ENSBTAP00000013720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]