SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013781 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000013781
Domain Number - Region: 388-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0135
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013781   Gene: ENSBTAG00000010439   Transcript: ENSBTAT00000013781
Sequence length 646
Comment pep:known chromosome:UMD3.1:7:8754284:8787049:1 gene:ENSBTAG00000010439 transcript:ENSBTAT00000013781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYENYGYGYGYGQDNTTNYG
YGMATSNSWEMPNSDTNANPSAMGSASADSVLSRINQRLDMVPHLETDMIQGGVYGSGGE
RYDSYEACDSRAVLSERDLYRSGYDYGELDPDMEMAYEGQYDAYRDQFRMRGSDTFGPRA
QGWARDSRSGRPMASGYGRMWEDPMGARGQCMPGASRLPSLFSQNIIPEYGMFQGMRGGG
TFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQCGSPDEPDSKATRTDCSDNS
DSDNDEGTEGEAAEGTEGAETVEKGSRAEGEDEEGKEEGKEGGKEDAEKGVLSAQDESGQ
AKRKLQAGKKSLDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYV
GTKLPKQTADFLQEYVANKTKKTEELRKTVEDLDGLIQQIYRDQDLTQEIAMEHFVKKVE
AAHCAACDLFIPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSILNNKLISKKLE
RYLKGENPFTDSPEEEKEQEEAEGGALDEGALVEAAGVAEGAEAAPAQPPVPPEPVPGAA
PPPPPPEEDEEAVPLLGGALERQIRGIPGLDVEADDDEEEGGGGAP
Download sequence
Identical sequences F1MMW4
9913.ENSBTAP00000013781 ENSBTAP00000013781 XP_002688606.1.76553 XP_005904206.1.15283 XP_010832286.1.44457 XP_869825.4.59421 ENSBTAP00000013781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]