SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013795 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013795
Domain Number 1 Region: 52-73,219-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000901
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 542-563,706-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000284
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013795   Gene: ENSBTAG00000010450   Transcript: ENSBTAT00000013795
Sequence length 965
Comment pep:known chromosome:UMD3.1:7:8742336:8750651:1 gene:ENSBTAG00000010450 transcript:ENSBTAT00000013795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLGSPPLPKKSLPVPGPLEQVANRLSSKMAAEVPHGSKQELPDLKAQSLTTCEVCGACF
ETRKGLSSHARSHLRQLGVAESESSGAPIDLLYELVKQKGLPDTPLGLPPSLTKKSNSPK
EIVAGAPRPGLLALAKPLDAPAVNKAIKSPPGFSAKGLAHPPNSPLLKKASLALAGSPTH
KNPEDKSPQLSLSPRPASPKAQWPQSEDEGPLNLTLDSDGGRELDCQLCGAWFETRRGLS
SHARAHLRHLGVSDPDAKGSPIDVLHGLIRRAGVQIRLPLGRGALALLGRPPPASAALSL
PPPPPPAKRAKLKAKGTASPWGKQDLPAAAAAGIFWASDVEPSPLNLSSGPEPARDIRCE
FCGEFFENRKGLSSHARSHLRQMGVTEWYVNGSPIDTLREILKRRTQSRPGGPPNPSGPS
PKALAKVVSSGGPGSSLEARSPADLHLSPLAKKLPPPPGSPLGHSPTVSPPPTARKMFPG
LSSPSLPKKLKPEQMRVEIKREMLPGALHGEPHPSEGPWVAPREDMTPLNLSSRAEPVRD
IRCEFCGEFFENRKGLSSHARSHLRQMGVTEWSVNGSPIDTLREILKKKSKPCLIKKEPP
AGDLAPALTEDGPPTVAPGPMQAPLPLAPMAGRPGKPGAGPAQIPRELTLAPITGTKHSA
TGYLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYF
ENRKALASHARAHLRQFGVTEWCVNGSPIETLSEWIKHRPQKAGAYRSYIQSGRPFTKKF
RSAGHGRDGDKRPPLGLAPGGLAVVGRGAGGEPGPEAGRAADSGERPLAASPPGTVKAEE
HQRQNINKFERRQARPPDASAARGSEEANDLHQKLEEVRQPPPRVRPVPALVPRPPQTSL
VKFVGNIYTLKCRFCEVEFQGPLSIQEEWVRHLQRHILEMNFSKADPPPEEPQAPQAQTA
AAEAP
Download sequence
Identical sequences F1MLJ0
ENSBTAP00000013795 ENSBTAP00000013795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]