SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013807 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013807
Domain Number 1 Region: 674-731
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.65e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 618-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.16e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.86e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 716-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000187
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 300-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000663
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 10 Region: 176-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000646
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 11 Region: 244-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000303
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013807   Gene: ENSBTAG00000031682   Transcript: ENSBTAT00000013807
Sequence length 790
Comment pep:known chromosome:UMD3.1:8:85224607:85232666:-1 gene:ENSBTAG00000031682 transcript:ENSBTAT00000013807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEWGEEPYMWNGKISSQGCLDQDIGFETSQQGVSEDVSVCFEGIRLFPRDDLYSILEEFW
QDNKQTGRDKENQNKHLSPIIFTNKDTLANKGNCDYKKDIGEKFHVNTNLVPSRKRLHNY
DSFQKSLKPIVSLCNCNRNNATENFDKIIGHGNTYMNSHTKTNACEYNQCKKLLSKQALI
QHQKHHTGEDFHVFSDCVKFSTHKTHLFAHQRIYTEEKHPECTKCEMIFTQKSQFAVPQV
YTKEKSYVGTEYGKKFSLNSNHEKTSHTEEIDYKCSARGKAFIKKLDLFRLQRIPTGGKK
PHDYSECGKNVSHNSNLSIHKKAHTGKKHFECIECGKSFTRKSTLSMHQKIHTGEKPYVC
TECGKAFIRKSHFITHERIHTGEKPYECNDCGKSFIKKSQLHVHQRIHTGENPFICSECG
KIFTHRTNLIIHQKIHTGERPYICTECGKAFTDRSNLIKHQKIHTGEKPYKCSDCGKSFT
WKSRLRIHQKCHTGERHYECNECGKAFIQKSTLSMHQRIHKGEKPYVCTECGKAFFHKSH
FITHERIHTGEKPYECSDCGKSFTKKSQLHVHQQIHTGEKPYRCAECGKAFTDRSNLFTH
QKIHTGEKPYKCDDCGKAFTRKSGLHIHQQSHTGERRYECSECGKAFARKSTLIMHQRIH
TGEKPYICTECGKSFIQKSHLNRHKRIHTGEKPYKCSDCGKAFIKKSQLLEHHRIHTGEK
PYICTECGKAFSIRSNLIKHQKIHTKQKPYKSSDFRKDFNWKAQFSVHQKSNTEEVECPV
PQSWGRDTKL
Download sequence
Identical sequences F1MPR5
ENSBTAP00000013807 ENSBTAP00000013807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]