SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013898 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013898
Domain Number 1 Region: 1740-1780,1818-2013
Classification Level Classification E-value
Superfamily Plakin repeat 7.24e-66
Family Plakin repeat 0.00000958
Further Details:      
 
Domain Number 2 Region: 1646-1769
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000497
Family Plakin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 282-404
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000259
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 4 Region: 155-225
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000864
Family Spectrin repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000013898
Domain Number - Region: 695-824,852-879
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00122
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number - Region: 523-625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00396
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013898   Gene: ENSBTAG00000010517   Transcript: ENSBTAT00000013898
Sequence length 2033
Comment pep:known chromosome:UMD3.1:19:56256889:56274684:1 gene:ENSBTAG00000010517 transcript:ENSBTAT00000013898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKGLSKSSQGKGSPKGSPAKGSPKGSPNKHSRAATQELALLISRMQANADQVERDILET
QKKLQQDRQHSEQRQALQHRQEVGRSLKEAEVLLKDLFLDVDKAQRLKHPQAEEIEKDIK
QLHERVTQECAEYRALYEKMVLPPDVGPRVDWARVLEQKQKQVCEGQYGPGMAELEQQVA
EHNILQKEIEAYGQQLRTLVGPDAATIRSQYRDLLKAASWRGQSLGSLYTHLQGCTRQLN
ALAQQQQRILQQDWSDHLADPAGVRREYEHFKQHELLSQEQRVNQLEDDGERMVELGHPA
VGPIQAHQEALKVEWQNFLNLCICQESQLQHVEDYRRFQEEADSVSQTLAKLNSSLDSQY
SPAPEGPPGALMEMLRQLEAEEKQLTMAEKTLKDLQLQSQGVAPLPQRRNLPLQPLRVDS
ICDWDSGEVQLLRGEQYTLVDNTDPHTWVVQGQAGEPKRAPAACFCIPAPDPEAVARASG
LASELQALKQKLTAVQSRLKASAKEPLRPSQQAPSSSGPPDPQAQKLLTQMTRLEEDLGQ
IEKQLLAWARAPLSRTTPLEDLEGRIQNHQGTAQRLQSLGAEKEAAQQKCEAFLSGQPSG
PAALHLPVVLNSVKNKYRDVQVLCSLYGEKAKAALGLERQIRDADKVIRGFESALAQEAP
IPAGPGALQERVSELKRRRRELLEQQACVLGLHRQLKAVEHMCSALQNNFCEFCKDLPHQ
QRQVRALTDRYHAVGDQLDLREKMMQDAGLTYQQFKNCTDNLNAWLERLPHNKVRPSDGP
SQIAYKLQAQKRLLQEIQGRKQDRATASRLSQHLQVALQDYELQADTYRGSLEPTQVGSA
PKRPRVAPLQDSIQAQEKNLTKAYTEVAAAHQQQLHQLEFARKILEKKELNEDIQVTPNA
QQGSESPARGGRKSEALRSQLEEERKRVAQVQRELEEQRSQLLQLKTQRPVEKLEEKEVV
EFYRDPQLESNLSRVKSQVEDEGKKQAGLQADLEAVAQKVMQLESQRKATEPHLLTKEVT
QIERDPGLDSQAAQLKSELQLLQEENTAVLAQLEALKAELLALEQKEVNVKETVVVKEVV
KVEKDLEMLQAAQALRLKIQEDVAQRKGAEDAVAKLQARVVELEAAIRTVEPKVIVKEVK
KVEQDPRLLQEASRLRSLLEVQRSENEVLARELKELHSKHSAAEKQKPRVDLQERVQETF
RVDPETEREIAQLRAELQETGRKRNGTEQEVERLLSELVVLRAQKPTVEYKEVTQELVRH
EKNPELLREIDRLKAQLNELVNGSGRAQEQLIRLQGERDEWRRERSKVETKTVNKEVVRR
EKDPVLEQEAQRLRQEVREATQKRRAAEDAVHQLQNKYLLLERRRPEERVVVQEVVVTQK
DPKLHEEHSRLSQSLDEEAGRRRQLEREVQQLQAAVQEDEGRLSFREDRSKKLAVERELR
QLTLKLQELEKRPPAVQEKIIMEEVVQLEKDPDLEKSTAALRQDLAQEKTQATEVHRECK
NLQVQIDVLQKTKLQEKTIYKEVIRVEKDPVLEGERARVWEALNRERAARESREEEVRRL
RERVERAEALGRTWAREEAELQKTRDRASQECRQLQQELRELERQKQQRVLHLQEESKLL
SQKTESERQRAAQRGQELSQLESAILREKDRIYEKERTLRDLHTQVSREELNQETQTRET
NISTKISILEPETGKDMSPYEAYKRGVIDRSQYLQLQDLECDWEEVTTSGPHGEESVLLD
RKSGKQYSIEAALRSRRISKEEYHLYKDGQLPISEFALLVAGETKPCPSLSIGAIISKSP
LASPASQSTSLFSPSFSLGLSEDSFPIAGVYDTTTDNKCTIKTAVAKNMLDPITGQKLLE
AQAATGGIVDLLSRERYSVHKAVERGLIESGSTQRLLNAQKAFTGIEDPVTKKRLSVGEA
VQKGWMPQESVLPHLRVQHLTGGLIDPKKTGRIPVAQAVLSGMISEELAQLLQDEASYEK
DLTDPISKERLSYREAMGRCRKDPLSGLLLLPASLEGYRCYRSASPTVPRSLR
Download sequence
Identical sequences E1B9N6
ENSBTAP00000013898 9913.ENSBTAP00000013898 NP_001192605.1.59421 NP_001192605.1.76553 ENSBTAP00000013898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]