SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013974 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013974
Domain Number 1 Region: 272-665
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000531
Family Hermes transposase-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000013974
Domain Number - Region: 122-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0488
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013974   Gene: ENSBTAG00000010568   Transcript: ENSBTAT00000013974
Sequence length 694
Comment pep:known chromosome:UMD3.1:15:42381063:42386360:1 gene:ENSBTAG00000010568 transcript:ENSBTAT00000013974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAHFLCILSYNVNTFVILNVYTKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSES
HDQKVGILQSEDEHLQPSVSKNSEGELSRVKFISNSNKITTFSKKPKRRKYDESYLSFGF
TYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNK
PPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKID
AVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNK
SIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAMDGKIAEAVTL
IKYVAPESTSSHCLLYRHALAVKTMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEM
GAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLAD
IFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINS
TVDKNICSAIVQHLRGLRSTLLKYFPVTNDIHAWVRNPFTVTVKPASLVARDYESLIDLT
SDSQVKQSFSELSLNDFWSSLIQEYPSVARRAVRVLLPFATMHLCETGFSYYAATKTKYR
KRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH
Download sequence
Identical sequences A4Z943
ENSBTAP00000013974 ENSBTAP00000013974 NP_001092858.1.59421 NP_001092858.1.76553 XP_005216103.1.76553 9913.ENSBTAP00000013974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]