SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013989 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013989
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily SNARE-like 2.34e-59
Family Clathrin coat assembly domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013989   Gene: ENSBTAG00000010584   Transcript: ENSBTAT00000013989
Sequence length 142
Comment pep:known chromosome:UMD3.1:18:54363679:54373314:-1 gene:ENSBTAG00000010584 transcript:ENSBTAT00000013989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
Download sequence
Identical sequences A0A098M0K6 A0A0B8RZP5 A0A151P423 A0A1D5QF91 A0A1S3A8H2 A0A1S3GH02 A0A1U7RDI0 A0A1U7SIQ6 A0A1W7RJE2 A0A250YA63 A0A287BIG4 A0A2H6NF15 A0A2J8U718 A0A2K5IZ79 A0A2K5LIR6 A0A2K5QZU2 A0A2K5UJQ9 A0A2K5YWU6 A0A2K6CPM7 A0A2K6MKR7 A0A2K6RVK8 E2RSJ0 E7BLG6 F6W1S9 G1QRH0 H0XXE6 H2QGN6 H3AWP7 H9GHZ5 J3RYE5 M3Y1A6 P53680 P62743 P62744 Q17QC5 Q3UJ76 Q5R940 T1E6I0 U3CLA1
ENSOGAP00000020789 ENSP00000263270 ENSMUSP00000083281 ENSBTAP00000013989 ENSRNOP00000021310 10090.ENSMUSP00000083281 10116.ENSRNOP00000021310 9544.ENSMMUP00000031555 9598.ENSPTRP00000019213 9600.ENSPPYP00000011367 9606.ENSP00000263270 9615.ENSCAFP00000006235 9796.ENSECAP00000013950 9823.ENSSSCP00000003362 ENSLACP00000014068 ENSBTAP00000013989 ENSDORP00000014383 ENSMUSP00000083281 ENSFCAP00000019563 ENSCAFP00000006235 ENSPTRP00000019213 ENSMPUP00000005107 ENSNLEP00000003538 ENSSSCP00000003362 ENSMPUP00000005107 1gw5S ENSCAFP00000006235 ENSPTRP00000019213 ENSP00000263270 ENSMMUP00000031555 ENSACAP00000011452 ENSPPYP00000011367 ENSRNOP00000021310 ENSMMUP00000001126 ENSOGAP00000020789 ENSECAP00000013950 2jkr_I 2jkr_S 2jkt_I 2jkt_S 2vgl_S 2xa7_S 4nee_D 4nee_F 4nee_I 4nee_L 4uqi_S ENSPPYP00000011366 ENSMUSP00000083281 ENSDORP00000014383 gi|70906430|ref|NP_004060.2| ENSNLEP00000003538 ENSLACP00000014068 000139946|e2xa7S1|223.2.1.2|S:1-142 000169308|e2jkrI1|223.2.1.2|I:1-142 000333893|e2vglS1|223.2.1.2|S:1-142 000351135|e2jkrS1|223.2.1.2|S:1-142 000351146|e2jktI1|223.2.1.2|I:1-142 000351147|e2jktS1|223.2.1.2|S:1-142 001140850|e4neeD1|223.2.1.2|D:1-142 001143324|e4neeL1|223.2.1.2|L:1-142 001143325|e4neeF1|223.2.1.2|F:1-142 001143326|e4neeI1|223.2.1.2|I:1-142 001318112|e4uqiS1|223.2.1.2|S:1-142 cath|current|1gw5S00/1-142 cath|current|2jkrI00/1-142 cath|current|2jkrS00/1-142 cath|current|2jktI00/1-142 cath|current|2jktS00/1-142 cath|current|2vglS00/1-142 cath|current|2xa7S00/1-142 cath|current|4neeD00/1-142 cath|current|4neeF00/1-142 cath|current|4neeI00/1-142 cath|current|4neeL00/1-142 cath|current|4uqiS00/1-142 d1gw5s_ d2jkri_ d2jkrs_ d2vgls_ d4need_ d4neef_ d4neei_ d4neel_ d4uqis_ ENSP00000263270 NP_001069546.1.59421 NP_001069546.1.76553 NP_001125999.1.23681 NP_001231381.1.46622 NP_001248072.1.72884 NP_004060.2.87134 NP_004060.2.92137 NP_075241.2.100692 NP_075241.2.4139 NP_941015.2.92730 XP_001373350.2.35504 XP_001917157.2.31192 XP_002923090.2.58354 XP_003228085.1.98722 XP_003277665.1.23891 XP_003799591.1.62490 XP_004271174.1.21590 XP_004381663.1.4749 XP_004400995.1.74151 XP_004440241.1.5094 XP_004607767.1.94378 XP_004694285.1.23501 XP_004767566.1.14098 XP_005086486.1.91757 XP_005283771.1.60341 XP_005361105.1.66349 XP_005589726.1.63531 XP_005589727.1.63531 XP_005857894.1.60319 XP_005900997.1.15283 XP_005996092.1.90931 XP_006032580.1.24877 XP_006067523.1.26621 XP_006142174.1.99106 XP_006175165.1.101512 XP_006208586.1.17985 XP_006277878.1.47583 XP_006746345.1.47382 XP_006772088.1.95426 XP_006868306.1.41390 XP_006898684.1.29581 XP_006911887.1.64745 XP_006991531.1.50099 XP_007102797.1.24612 XP_007458549.1.90284 XP_007531027.1.11023 XP_007608412.1.28591 XP_007649345.1.69978 XP_007941072.1.48129 XP_008152659.1.99482 XP_008542828.1.77740 XP_008574119.1.73410 XP_008820001.1.79516 XP_008986523.1.60252 XP_010375720.1.97406 XP_010850956.1.44457 XP_010945161.1.22495 XP_010996017.1.51371 XP_011366202.1.92234 XP_011734357.1.29376 XP_011734358.1.29376 XP_011818327.1.43180 XP_011818328.1.43180 XP_011825082.1.47321 XP_011936033.1.92194 XP_011983441.1.54773 XP_012302161.1.9421 XP_012616959.1.48125 XP_012888086.1.60039 XP_013827018.1.57651 XP_015279600.1.55130 XP_015352141.1.40921 XP_015676483.1.16292 XP_016010842.1.101085 XP_016072231.1.3490 XP_017194320.1.1745 XP_017355874.1.71028 XP_017530161.1.32401 XP_017729788.1.44346 XP_019281443.1.44245 XP_019480778.1.44202 XP_019608163.1.88060 XP_020026421.1.5219 XP_020642733.1.8467 XP_020753715.1.74333 XP_020948981.1.46622 XP_020948982.1.46622 XP_021074961.1.100879 XP_021499815.1.76796 XP_021499816.1.76796 XP_021536858.1.83697 XP_512774.1.37143 XP_533634.1.84170 ENSSSCP00000003362 ENSECAP00000013950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]