SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014572 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014572
Domain Number 1 Region: 34-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.54e-40
Family Frizzled cysteine-rich domain 0.000000209
Further Details:      
 
Domain Number 2 Region: 178-289
Classification Level Classification E-value
Superfamily TIMP-like 2.67e-26
Family Tissue inhibitor of metalloproteinases, TIMP 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014572   Gene: ENSBTAG00000010977   Transcript: ENSBTAT00000014572
Sequence length 325
Comment pep:known chromosome:UMD3.1:2:13724668:13761787:1 gene:ENSBTAG00000010977 transcript:ENSBTAT00000014572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCGSRGGMLLLPAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPESLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
KPVRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKASLVNIPRETVNLYTS
SGCLCPPLNVNEEYLIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLNT
SDSSHSDSTQSQKPGRNSNSRQARN
Download sequence
Identical sequences Q95117
NP_776484.1.59421 NP_776484.1.76553 XP_005202312.1.76553 XP_005202313.1.76553 XP_006071843.1.26621 XP_010851228.1.44457 XP_010851233.1.44457 XP_010851237.1.44457 XP_010851243.1.44457 XP_010851249.1.44457 XP_015330109.1.76553 XP_019825296.1.53367 ENSBTAP00000014572 ENSBTAP00000014572 9913.ENSBTAP00000014572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]