SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014617 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014617
Domain Number 1 Region: 131-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.06e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000373
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 451-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000056
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000014617
Domain Number - Region: 107-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0385
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014617   Gene: ENSBTAG00000011003   Transcript: ENSBTAT00000014617
Sequence length 509
Comment pep:known chromosome:UMD3.1:19:40779127:40864311:-1 gene:ENSBTAG00000011003 transcript:ENSBTAT00000014617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDIKPNVELKSTQEQSVPTEGSELLNDYDLTKAHETENVDGTEGPANEDEDIGDDSMKV
KDEYSERDENVLKPEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSYDSSRPTSGKMNC
DVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCN
YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDLGETASVH
AKHLKSQQKNKRLTKMDRLASNVAKRKSSMPQKFIGEKRHCFDVSYNPSYMYEKESEMIQ
TRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMPNGAPQELE
KKNIHLPEKSLPSERGLSPTNSGHDSTDTDSNHEERQNHIYQQNPMVPPRARNGMPLLKE
GPRSYDLLKPPPICPRDSIKVINKEGEVTDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPF
ECNMCGYRSHDRYEFSSHIARGEHRAMLK
Download sequence
Identical sequences G5E5E5
ENSBTAP00000014617 ENSBTAP00000014617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]