SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014826 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014826
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.39e-34
Family SCAN domain 0.0000974
Further Details:      
 
Domain Number 2 Region: 786-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 842-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 883-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000148
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 5 Region: 227-285
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000824
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 
Domain Number 6 Region: 738-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000992
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014826   Gene: ENSBTAG00000011162   Transcript: ENSBTAT00000014826
Sequence length 969
Comment pep:known chromosome:UMD3.1:25:23091497:23104117:-1 gene:ENSBTAG00000011162 transcript:ENSBTAT00000014826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLDPQTDAPLEVEGCLIMKVEKEPEWISEPTLEGSDSSESETFRRCFRQFCYEDVTG
PHEAFSKLWELCCRWLKPEMRSKEQILELLVIEQFLTILPEKIQLWAQKQCPESGEEAVA
LVIHLEKETGGLRQQVSSPVHSEKQAPLGAAWEVADFQPQPVEPQPRVMSQEEAESLHSG
RQEQPNQKRELRPLPKNARPSPWVPSPANEWNTIDQEVTATPVPVRSQGPVKDVHMARGF
SYKKSVHQIPAHKDLYRDIRKESVGNMVSLGSTVSAANKIARLEPRKEPWTISLQSSNKR
TVLQSNYIKEKSVHAIQIPARNAGKTWREQQQWGLEDEKIAGVHWSYEETKTFLAILKES
RFYETLQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHVLEPCAF
FEDMDALLNPSAHASSMDKPKEILSLPRLKRIGISAKEQINLVEEEEAAEESDGDEMGIE
FIRKPELHGAPVIFQNLSGVHWGYEETKTFLDILHETRFYEALQACHRKSKLYGAVAEQL
RECGFLRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINSRASAAPTSSPEEA
PSPSVQEREDMEIEPQEPTVWEPEEDSQEVLVEDSGSERMSEEEIMQEPEFQGPPCLLQS
PSDFEIESSIKEDATQVICKDMEQHRAFIEKSKRVVSQNVDPGKYCKRDCVSGGQWENLH
GIRQGKLMPQPRDLGKAVVHQRPLVGKRPFRLLRYGESFGRSARLMCRMTHQKENPSKCS
VCGKCFGRSRSLVRHQRIHTGEKPFKCLDCGKSFNDSSNFGAHQRIHTGEKPYRCGECGK
CFSQSSSLIIHQRTHTGEKPYQCGDCGRSFTNSSHFSAHRRVHTGENPYKCVDCEKSFNN
CTRFREHRRVHSGEKPYGCSQCGRRFSKSSVLTKHREVHVREKLLPPPPAFCSPENPLKG
KTDDFRQTL
Download sequence
Identical sequences E1BN90
9913.ENSBTAP00000014826 ENSBTAP00000014826 ENSBTAP00000014826 NP_001192599.1.59421 NP_001192599.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]