SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014875 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014875
Domain Number 1 Region: 409-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000495
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000014875
Domain Number - Region: 964-985,1033-1060
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000123
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Domain Number - Region: 581-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.05
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014875   Gene: ENSBTAG00000011200   Transcript: ENSBTAT00000014875
Sequence length 1327
Comment pep:known chromosome:UMD3.1:3:52413191:52508199:1 gene:ENSBTAG00000011200 transcript:ENSBTAT00000014875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLQRDVNKTKSRLNVLNGLTNNMDDLKINTDVTGAKEELLDDNSFISDKESGVHKPK
DCQASFQKNNTFTLPEELSKDKSEKALSGGQSTLFIHAGAPTVSSENFILPKGAAVNGPV
SHSSLTKTSNMNKGSVSLTTGQPVDQPTTESCSGLKVAADLQLSTPQKASQHQVLFLLSD
VAHAKNPTHSIKKLPTSASIGCDIQNSVGSGIKSDSTLINQVEVGEDSEDLLVKNDCVST
LTGISSGTDEFRSDNDTNWDPQKEFIQFLITNDDTVDKAPVHSKVGLEKKRKRKMDVSKI
TRYTEDCFSDSNCVPNKSKMLEVDFMEQNEDVQAIDSRTYALSQVKPESADEDLESVDTF
QHLIFNSDKCGEDSSPVHTSTFLSNTLKKKCEESDSESPVTFSTEEPSFYPCTKCNVNFR
EKKHLHRHMMYHLDGNSHFRHLNVPRPYACRECGRTFRDRNSLLKHMIIHQERRQKLMEE
IRELKELQDEGRSARLQCPQCVFGTNCPKTFVQHAKTHEKDKRYYCCEECNFMAVTENEL
ECHRGIAHGAVVKCPIVSSDVVQRKTHKKAFMKDPVIGSSKKSATYICKMCPFTTSVKSI
FKKHMEYLHSSSCIDSFGSPLGLDKRKSDIIEEPIDTDSPKPLTKQQSTTFPKNSALKQD
VKRTFGSSSQSSNFSKFHKRPHRIQKARKSIAQSGVNVCSQNSSPHKTVMIKSSIDQKPK
YFHQTAKEKSNAKANSNYLYRHKYENYRMIKKSGESYPLHFKKEEASSLNSLHLFSSSNS
HNNSFISDPHNSDTKRPEGFKDHRRVAVKRVVKESKKESSVGGEDLDSYPDFLHKMTVVV
LQKLNSTEKKDSYETEDESSWDNVELGDYTTQTIEDETYHDINQEHVNIFPLFKSKVEGQ
QSGENATLSYDQNDGFYFEYYEDGGTNNFLHEIHDPQHLENAETALSKHSSVFHWTDLSL
EKKSCPYCPATFETGVGLSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGTGT
PIKRVRKAIEKSETTSEHTCQLCGGWFDTKIGLSNHVRGHLKRLGKTKWDAHKSPICVLN
EMMQNEEKYEKILKALNSRRIIPRPFVAQKLASSDDFLSQNVIPLEAYRNGLKTEALSVS
ASEEEGLSFLNEYDETKPELPSGKKNQSLTLIELLKNKRMGEEKNSSVSPQKIHNQTARK
RFVQKCVLPLNEDSPLMYQPQKMDFTMHSALDCKQKKSRSRSGSKKKLLTLPHGADEVYI
LRCRFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSL
LMAEAAS
Download sequence
Identical sequences A3KMW9
ENSBTAP00000014875 NP_001076082.1.59421 NP_001076082.1.76553 9913.ENSBTAP00000014875 ENSBTAP00000014875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]