SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014919 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014919
Domain Number 1 Region: 6-34
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000262
Family CHHC finger 0.013
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000014919
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0964
Family CHHC finger 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014919   Gene: ENSBTAG00000011233   Transcript: ENSBTAT00000014919
Sequence length 169
Comment pep:known chromosome:UMD3.1:13:72984200:72985097:-1 gene:ENSBTAG00000011233 transcript:ENSBTAT00000014919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEALETCPYNPHHRIPLSRFQYHLASCRRKNPKKAKKMASCKYNACHVVPIKKLEEHE
AACVNKSTMEEEDSLSPLKVSLPNAGQKGNRNASPVSPRLPNPDLWNVDSTNCHPMFVLK
SFIPQKLVCESDTRESETDDHNPIPDCPRRRSSDRESEPPAEDTSLLKA
Download sequence
Identical sequences Q3T026
9913.ENSBTAP00000014919 ENSBTAP00000014919 NP_001073069.1.59421 NP_001073069.1.76553 ENSBTAP00000014919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]