SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014963 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014963
Domain Number 1 Region: 335-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 279-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 16-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-21
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 5 Region: 460-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-18
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 236-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000242
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 381-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000189
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 8 Region: 206-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000125
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014963   Gene: ENSBTAG00000011262   Transcript: ENSBTAT00000014963
Sequence length 549
Comment pep:known chromosome:UMD3.1:18:64782536:64787765:-1 gene:ENSBTAG00000011262 transcript:ENSBTAT00000014963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGITKTDEVSIWEMDPRQDCVVFEDVAVYFSQEEWGLLDETQRHLYHAVMTENLALVTSL
GCCHGAQGEEASSEQGVSIGMSEVRTAKPDPSSRKAQPGDMCGPLSRDLLPLPEHDRMYP
DEGLYVCGADLFQHQKEIRDKLCRRAEGQPSFVTNSSVHTGERTLTCSRDGKPFLGSTGL
LQQLAPRGVGQPHGDTECQEAFGHEQSGYRCTQCGKAFSRKQILVEHQKIHTGRVHTGLR
PYECSKCGEFFKYNANFMKHQRKHNGERPFECRECGKFFRYNYRLIRHGRVHTGETPYKC
IECGKFFRYSSTFIRHQRVHTAEKPYKCNECGKFFRYNSTLIKHQRVHTGERPYECSECG
KFFRYTSTLIRHQRVHTVERPYECSLCGEYFKYKSKLIKHWQNHTGERPYECSECGKAFR
YHCRLIRHKRVHSGERPYECSECGKFFRYNSNLIKHWRNHTGERPYECRECGKAFSHKHI
LVEHQKIHTGERPYECSRCHKAFIRKSHLVHHQKIHTEDTMSAVNVGNSLDTTPTSLNVS
DFTVEKGLS
Download sequence
Identical sequences F1N131
ENSBTAP00000014963 ENSBTAP00000014963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]