SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014968 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014968
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily POZ domain 4.71e-29
Family BTB/POZ domain 0.000000707
Further Details:      
 
Domain Number 2 Region: 555-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 499-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-16
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 4 Region: 419-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000413
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 596-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000154
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014968   Gene: ENSBTAG00000011266   Transcript: ENSBTAT00000014968
Sequence length 673
Comment pep:known chromosome:UMD3.1:15:24917133:25116350:1 gene:ENSBTAG00000011266 transcript:ENSBTAT00000014968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMAEGGAEEEEDRKARYLKNIFISKHSSEESGYASVAAQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGALQPPAGPEEPTLAGGGRHPAVAE
VKPEMMQVDEVPGQESPGTVESSISAGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESTEQLPPPVEAGQGPPGRLEPPAHPAEKHLGLYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKAESRSVGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEEALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICSEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
Download sequence
Identical sequences Q32PJ4
ENSBTAP00000014968 ENSBTAP00000014968 9913.ENSBTAP00000014968 NP_001032553.1.59421 NP_001032553.1.76553 XP_005215906.1.76553 XP_005215907.1.76553 XP_005215908.1.76553 XP_019830116.1.53367 XP_019830117.1.53367 XP_019830118.1.53367 XP_019830119.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]